KEGG   Shigella boydii Sb227 (serotype 4): SBO_2039
Entry
SBO_2039          CDS       T00301                                 

Gene name
ycdB
Definition
(GenBank) conserved hypothetical protein
  KO
K16301  deferrochelatase/peroxidase EfeB [EC:1.11.1.-]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbo02000]
    SBO_2039 (ycdB)
Enzymes [BR:sbo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     SBO_2039 (ycdB)
Transporters [BR:sbo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SBO_2039 (ycdB)
SSDB
Motif
Pfam: Dyp_perox
Other DBs
NCBI-ProteinID: ABB66622
ShiBASE_China: SBO2039
UniProt: Q31Z86
Position
complement(2006069..2007340)
AA seq 423 aa
MQYKDENGVNEPSRRRLLKVIGALALAGSCPVAHAQKTQSAPGTLSPDARNEKQPFYGEH
QAGILTPQQAAMMLVAFDVLASDKADLERLFRLLTQRFAFLTQGGAAPETPNPRLPPLDS
GILGGYIAPDNLTITLSVGHSLFDERFGLAPQMPKKLQKMTRFPNDSLDAALCHGDVLLQ
ICANTQDTVIHALRDIIKHTPDLLSVRWKREGFISDHAARSKGKETPINLLGFKDGTANP
DSQNDKLMQKVVWVTADQQEPAWTIGGSYQAVRLIQFRVEFWDRTPLKEQQTIFGRDKQT
GAPLGMQHEHDVPDYASDPEGKVIALDSHIRLANPRTAESESSLMLRRGYSYSLGVTNSG
QLDMGLLFVCYQHDLEKGFLTVQKRLNGEALEEYVKPIGGGYFFSLPGVKDANDYLGSAL
LRV
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgcagtataaagatgaaaacggcgtgaatgaaccgtcacgccgacgtttactgaaagtg
ataggtgcgctggcgctggcgggaagttgtccggtcgctcatgcacaaaaaacgcaaagt
gcgccgggtacgctttcaccggatgcacgcaatgagaaacagccgttttatggtgagcat
caggcagggatcctgacgccacaacaggccgcaatgatgctggtggcgtttgatgtgctt
gccagcgataaagccgatcttgaacggttgtttcgcttgttgactcagcgttttgctttt
ctgactcagggcggagcggcaccagaaacgccaaatccgcgcctgccaccactcgattcc
ggcattcttggcggctacattgcgcccgataatctcaccatcacgttatcggtgggtcac
tcattgtttgatgagcggtttggccttgcgccacagatgccgaaaaagttgcagaagatg
acgcgtttccccaacgactcgctggatgcggcgttatgccatggtgatgtgttgctacaa
atttgcgccaacacccaggacacggtgatccatgcgctgcgcgatatcatcaaacacacg
ccggatttgctcagcgtgcgctggaagcgggaagggtttatttccgatcacgcagcgcgt
agtaaaggcaaagagacgccgattaatttgctgggctttaaagacggcactgccaatccc
gatagccagaatgataagttgatgcaaaaagtggtgtgggtaacggcagatcagcaggag
cctgcgtggacaatcggtggcagctatcaggcagtacgcttgattcagtttcgagtggaa
ttttgggacagaacgccgctgaaagaacagcagacgatttttggccgtgataagcaaacc
ggtgcgccgctgggaatgcagcatgagcatgatgtgcctgattacgccagcgacccggaa
gggaaggtgatcgcgctggacagccatatccggctggcgaatccccgcacggcggagagt
gagtccagcctgatgctgcgtcgcggctacagttattcgttgggggtcaccaactccgga
caactggatatggggttgctgtttgtctgctaccaacacgatctggaaaaaggcttcctg
acagtacaaaaaaggctcaatggcgaagcgctggaggaatacgttaaacctatcggcggc
ggttattttttttcgctgccgggagtgaaggacgcgaacgattatctcggaagcgcgtta
ttgcgggtttaa

DBGET integrated database retrieval system