KEGG   Shigella boydii Sb227: SBO_2736Help
Entry
SBO_2736          CDS       T00301                                 

Gene name
yqeF
Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbo  Shigella boydii Sb227
Pathway
sbo00071  Fatty acid degradation
sbo00280  Valine, leucine and isoleucine degradation
sbo00310  Lysine degradation
sbo00362  Benzoate degradation
sbo00380  Tryptophan metabolism
sbo00620  Pyruvate metabolism
sbo00630  Glyoxylate and dicarboxylate metabolism
sbo00640  Propanoate metabolism
sbo00650  Butanoate metabolism
sbo00900  Terpenoid backbone biosynthesis
sbo01100  Metabolic pathways
sbo01110  Biosynthesis of secondary metabolites
sbo01120  Microbial metabolism in diverse environments
sbo01130  Biosynthesis of antibiotics
sbo01200  Carbon metabolism
sbo01212  Fatty acid metabolism
sbo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SBO_2736 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    SBO_2736 (yqeF)
   00640 Propanoate metabolism
    SBO_2736 (yqeF)
   00650 Butanoate metabolism
    SBO_2736 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SBO_2736 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    SBO_2736 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SBO_2736 (yqeF)
   00310 Lysine degradation
    SBO_2736 (yqeF)
   00380 Tryptophan metabolism
    SBO_2736 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SBO_2736 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SBO_2736 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SBO_2736 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbo04147]
    SBO_2736 (yqeF)
Enzymes [BR:sbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SBO_2736 (yqeF)
Exosome [BR:sbo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SBO_2736 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABB67264
ShiBASE_China: SBO2736
UniProt: Q31XE4
Position
complement(2749461..2750645)
Genome map
AA seq 394 aa AA seqDB search
MMKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTA
GAGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMS
RAPHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYA
LSSQQKARAAIDAGRFKDEIVPVMIQSNGQTLVVDTDEQPCTDASAEGLARLNPSFDSLG
SVTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRC
LERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILV
SLVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgtggt
gcgttagcgggtcattccgccgtggaacttggtagtttggtcgtgaaagcgttaatagaa
cgtaccggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgca
ggggcagggcagaatccggcaaggcaatcggctattaaaggtggtcttcctaatagcgtt
tctgcaatcactattaatgacgtttgcggttctgggcttaaagcactgcatctggctact
caggcgatacagtgtggcgaggctgatattgtcatcgccggtggccaggaaaacatgagc
cgcgcaccacatgttctgactgatagccgcaccggtgcacagcttggcaatagccagttg
gttgacagtctggtgcatgatgggttgtgggatgccttcaatgattatcatattggtgtc
accgccgaaaatctggctcgcgaatatggcatcagccgtcagttgcaggatgcttacgca
cttagctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatc
gtcccggtaatgatccaaagtaacggtcagacgttggttgttgataccgatgaacagcca
tgcactgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggt
tctgtgaccgcggggaatgcatcatccataaacgatggcgcagctgcggtaatgatgatg
agcgaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgcc
agcgttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgc
ctggagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgttt
gctgcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtc
aatggtggcgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtt
tctctggttcatgaaatggtgaaacgtaatgcccgcaaagggctggcaacgctttgtatc
ggcgggggccagggcgtggcattgaccattgaacgtgacgagtag

DBGET integrated database retrieval system