KEGG   Shigella boydii Sb227 (serotype 4): SBO_3555Help
Entry
SBO_3555          CDS       T00301                                 

Gene name
yiaE
Definition
(GenBank) putative dehydrogenase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo00030  Pentose phosphate pathway
sbo00260  Glycine, serine and threonine metabolism
sbo00620  Pyruvate metabolism
sbo00630  Glyoxylate and dicarboxylate metabolism
sbo01100  Metabolic pathways
sbo01110  Biosynthesis of secondary metabolites
sbo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SBO_3555 (yiaE)
   00620 Pyruvate metabolism
    SBO_3555 (yiaE)
   00630 Glyoxylate and dicarboxylate metabolism
    SBO_3555 (yiaE)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBO_3555 (yiaE)
Enzymes [BR:sbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     SBO_3555 (yiaE)
    1.1.1.81  hydroxypyruvate reductase
     SBO_3555 (yiaE)
    1.1.1.215  gluconate 2-dehydrogenase
     SBO_3555 (yiaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABB68037
ShiBASE_China: SBO3555
UniProt: Q31V71
Position
3564172..3565158
Genome map
AA seq 328 aa AA seqDB search
MERSMKPSVILYKALPDDLLQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENV
DAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTAR
RVVEVAERVKAGEWTASIGPDWYGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNA
RRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAEQFAKMKPSAIFINAG
RGPVVDENALIAALQKGEIHAAGLDVFEQEPLSVDSPLLSMANVVAVPHIGSATHETRYG
MAACAVDNLIDALQGKVEKNCVNPHVAD
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggagagaagcatgaagccgtccgttatcctctacaaagccttacctgatgatttactg
caacgcctgcaagagcatttcaccgttcaccaggtggcaaacctcagcccacaaaccgtc
gaacaaaatgcagcaatttttgccgaagctgaaggtttactgggttcaaacgagaatgta
gatgccgcattgctggaaaaaatgccgaaactgcgtgccacatcaacgatctccgtcggc
tatgacaattttgatgtcgatgcgcttaccgcccgaaaaattctgctgatgcacacgcca
accgtattaacagaaaccgtcgccgatacgctgatggcgctggtgttgtctaccgctcgt
cgggttgtggaggtagcagaacgggtaaaagcaggcgaatggaccgcgagcataggcccg
gactggtacggcactgacgttcaccataaaacactgggcattgtcgggatgggacggatc
ggcatggcgctggcacaacgtgcgcactttggcttcaacatgcccatcctctataacgcg
cgccgccaccataaagaagcagaagaacgcttcaacgcccgctactgcgatttggatact
ctgttacaagagtcagatttcgtttgcctgatcctgccgttaactgatgagacgcatcat
ctgtttggcgcagaacaattcgccaaaatgaaaccctccgccattttcattaatgccgga
cgtggcccggtggttgacgaaaatgcactgatcgcagcattgcagaaaggcgaaattcac
gccgccgggctggatgtcttcgaacaagagccactgtccgtagattcgccgttgctctca
atggccaacgtcgtcgcagtaccgcatattggatctgccacccatgagacgcgttatggc
atggccgcctgtgccgtggataatttgattgatgcgttacaaggaaaggttgagaagaac
tgtgtgaatccgcacgtcgcggactaa

DBGET integrated database retrieval system