KEGG   Shigella boydii Sb227 (serotype 4): SBO_3899Help
Entry
SBO_3899          CDS       T00301                                 

Gene name
yihX
Definition
(GenBank) putative phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo00010  Glycolysis / Gluconeogenesis
sbo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBO_3899 (yihX)
Enzymes [BR:sbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     SBO_3899 (yihX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD PNK3P
Motif
Other DBs
NCBI-ProteinID: ABB68350
ShiBASE_China: SBO3899
UniProt: Q31UA8
Position
3926538..3927158
Genome map
AA seq 206 aa AA seqDB search
MARKEAKMLYIFDLGNVIVDIDFNRVLGAWSDLTRVPLATLKKSFHMGEAFHQHERGEIS
DEAFAEALCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLH
TTFWPEEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEG
ANQLGITSILVKDKTTIPDYFAKVLC
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgaaaggaggcaaaaatgctctatatctttgatttaggtaatgtgattgtcgat
atcgactttaaccgtgtgctgggagcctggagcgatttaacgcgtgttccactggctacg
cttaagaagagttttcatatgggggaggcgtttcatcagcatgagcgtggggaaattagc
gacgaagcgttcgcagaggcgctgtgtcatgagatggctctaccgctaagctacgagcag
ttctctcacggctggcaggcggtgtttgttgcgctgcgcccggaagtgatcgccatcatg
cataaactgcgtgagcaggggcatcgcgtggtggtgctttccaataccaaccgcctgcat
accaccttctggccggaagaatacccggaaattcgtgatgctgctgaccatatctatctg
tcgcaagatctggggatgcgcaaacctgaagcacgaatttaccagcatgttttgcaggcg
gaaggtttttcacccagcgatacggtctttttcgacgataacgccgataatatagaagga
gccaatcagctgggcattaccagtattctggtgaaagataaaaccaccatcccggactat
ttcgcgaaggtgttatgctaa

DBGET integrated database retrieval system