KEGG   Shewanella baltica OS223: Sbal223_0020Help
Entry
Sbal223_0020      CDS       T00803                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00071  Fatty acid degradation
sbp00280  Valine, leucine and isoleucine degradation
sbp00281  Geraniol degradation
sbp00310  Lysine degradation
sbp00362  Benzoate degradation
sbp00380  Tryptophan metabolism
sbp00410  beta-Alanine metabolism
sbp00640  Propanoate metabolism
sbp00650  Butanoate metabolism
sbp00903  Limonene and pinene degradation
sbp00930  Caprolactam degradation
sbp01040  Biosynthesis of unsaturated fatty acids
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
sbp01130  Biosynthesis of antibiotics
sbp01200  Carbon metabolism
sbp01212  Fatty acid metabolism
Module
sbp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sbal223_0020
   00650 Butanoate metabolism
    Sbal223_0020
  Lipid metabolism
   00071 Fatty acid degradation
    Sbal223_0020
   01040 Biosynthesis of unsaturated fatty acids
    Sbal223_0020
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sbal223_0020
   00310 Lysine degradation
    Sbal223_0020
   00380 Tryptophan metabolism
    Sbal223_0020
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sbal223_0020
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sbal223_0020
   00281 Geraniol degradation
    Sbal223_0020
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sbal223_0020
   00930 Caprolactam degradation
    Sbal223_0020
Enzymes [BR:sbp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sbal223_0020
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sbal223_0020
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sbal223_0020
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Sbal223_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACK44564
UniProt: B8E3R3
Position
complement(22898..25048)
Genome map
AA seq 716 aa AA seqDB search
MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLASLDAALDSIKQDSNIKALVLTSS
KDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCET
ILTTDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRAEDALK
VGAVDAVVAPQALEAAAIQMLKDAVAEKLDWQARRNRKLSALTLPKLEAMMSFTTAKGMV
FAVAGKHYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLAKTDVAKALIGIFLNDQFVK
GKAKKAGKLAKEVNNAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAAKLL
SAQVARGRSTPEKMAKVLNNITPSLDYAAIKHSDVVVEAVVEHPKIKAQVLAEVEGYVSE
DAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMFENKRLGQKNGKGFYVYSVDSRGKP
KKDVDPTSYGLLKDAFGELKAFEADDIIARTMIPMIIETVRCLEEGIVASPAEADMGLVY
GLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRTLAANNGSYYQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagtcctacaattcaggttgagttactcgaggataatattgccaagctg
tgctttaacgcacccggttcggtgaacaaattcgacagagaaaccctcgcctcgctcgat
gcggcattagacagcatcaagcaagattccaatatcaaagcgttagtgctgacctcaagt
aaagatacctttattgtgggcgccgacattaccgaatttttaggcctgttcgcacaagat
gacgccgtattgctctcttgggttgaacaagccaacgcagtcttcaacaaactcgaagac
ttgcctttcccaactgcatcagcaatcaaaggctttgccttaggtggcggctgtgaaacc
attctgacaaccgatttccgtatcgcagacaccacagccaaaatcggtttacctgaaact
aaactcggcatcatcccaggttttggcggcacagttcgtctgccacgtgtgattggtgca
gataacgcacttgagtggatcaccacaggtaaagaccaacgcgctgaagatgcactgaaa
gtcggcgctgttgatgccgtggttgcaccacaagcgttagaagctgctgcgattcaaatg
ctgaaagatgctgttgctgaaaagctggattggcaagcacgtcgtaaccgtaaactgtct
gcactaacactgccaaaacttgaagctatgatgtcattcaccacagccaaaggcatggtg
tttgcggttgcgggtaaacactaccctgcaccaatggctgctgtaagcgtgattgagcaa
gcatcgactaaaggtcgtgctgaagcattacaaatcgaacatcaagcctttatcaagctg
gctaaaactgacgttgctaaggcacttatcggtattttccttaacgatcaattcgttaaa
ggtaaagcgaagaaagctggcaagttagcgaaagaagtcaacaacgcggccgtattaggt
gcaggcattatgggcggcggcatcgcttaccaaagcgccagcaaaggcacaccgattgtc
atgaaagacattgcccagccagcattagatttaggcctcaatgaagccgctaaactgctg
tctgcccaagtcgcccgtggccgttcaacgccagaaaaaatggccaaagtgctgaacaac
attacgccttcgttagattatgccgcgattaaacacagtgatgttgtcgttgaagccgtt
gttgaacatccaaaaatcaaagcacaggttttagccgaagttgaaggttatgtgagtgaa
gatgcaattatcgcctcaaacacttcaacgatttcaatcaacttgctcgctaagagcatg
aagaaaccagagcgtttctgcggtatgcatttcttcaacccagtgcacaaaatgcctttg
gtcgaagtgatccgtggcgagcacagctctgaagaaaccatcgcctctgttgtggcttat
gccagcaaaatgggtaagaccccaatcgttgttaatgattgcccaggcttcttcgttaac
cgcgtactcttcccttactttgcaggctttaacggcttacttgccgaaggtggcgacttt
gctgcaatagacaaagtgatggaaaaacaattcggttggccaatgggtccagcttacctg
ctcgacgtagtcggtttagacacaggtcatcacgcccaagctgtaatggctgaaggtttc
cctgatcgcatgggtaaatctggtactgacgcgattgatgtgatgtttgagaacaaacgt
cttggccagaaaaatggcaaaggtttctatgtctattccgtcgatagccgtggcaagccg
aagaaagatgtcgatccaacaagctacggtctattgaaagatgcctttggcgagttaaaa
gccttcgaagccgatgacattattgcccgtactatgatccctatgatcattgaaaccgtg
cgctgtttagaagaaggtattgtcgcatcgcctgccgaagcggatatgggcctagtttat
ggcttaggattcccgccattcagaggcggcgtgttccgttacttggataccatgggtgtc
gcaaactttgtggccttagcagacaaatacgctcacttgggcggtctgtatcaagtcaca
gatgcgatgcgcacattagcagccaataacggtagctactaccaagcctaa

DBGET integrated database retrieval system