KEGG   Shewanella baltica OS223: Sbal223_0397Help
Entry
Sbal223_0397      CDS       T00803                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00790  Folate biosynthesis
sbp01100  Metabolic pathways
Module
sbp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal223_0397
Enzymes [BR:sbp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sbal223_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACK44931
UniProt: B8E4J0
Position
complement(443046..443696)
Genome map
AA seq 216 aa AA seqDB search
MALSEAAVKVQAALLERGLETPMLPSVYSSEERKDKIEHHMKEILTLMSLDLSDDSLADT
PRRIAKMYVDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTAT
IAYLPRKKIIGLSKINRIVRFFAQRPQVQERLTQQVLVALQTLLETKDVAVKMDAVHYCV
KSRGVMDSTSSTTTTALGGIFKSNPATRAEFLHQSK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtgaagcagcagtaaaagtacaagccgcgttattagaacgtgggcttgaa
accccaatgctcccaagcgtttacagcagtgaagaacgtaaagacaagattgaacatcat
atgaaagaaatcctgacattaatgtcattggatctgtcagacgatagccttgccgatacg
ccgcgccgcattgctaaaatgtacgtcgatgaaatcttctctggcttagattatgcgaac
ttccctaagatcacagttatcgacaataagatgggcttcgatgaaatggtgcgagtgcaa
gacattagcctcaccagtacctgcgaacaccatttagtgacgatcgatggcactgcgacc
atagcttatctaccacgcaaaaaaatcattggtttatcaaagattaatcgcatcgtgcgt
ttctttgcccaacgtccacaggtgcaagagcgtttgactcagcaagtgttagtcgcgcta
caaaccttgcttgaaaccaaagacgttgcggttaaaatggatgcagtgcattactgcgta
aaatcccgtggcgtgatggactcaaccagttcaaccaccaccacagcgctgggcggtatt
ttcaagtctaaccctgcgacccgcgccgagtttttgcaccagtctaaataa

DBGET integrated database retrieval system