KEGG   Shewanella baltica OS223: Sbal223_0501Help
Entry
Sbal223_0501      CDS       T00803                                 

Definition
(GenBank) ribosomal protein L31
  KO
K02909  large subunit ribosomal protein L31
Organism
sbp  Shewanella baltica OS223
Pathway
sbp03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Sbal223_0501
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sbp03011]
    Sbal223_0501
Ribosome [BR:sbp03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    Sbal223_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L31
Motif
Other DBs
NCBI-ProteinID: ACK45035
UniProt: B8E6H2
Position
571724..571936
Genome map
AA seq 70 aa AA seqDB search
MKPGIHPKYAIITANCTCGNVIKVNSTAGKDLHLDVCGACHPFYTGTQKVVDTGGRIDKF
NKRFAVLAKK
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaggtatccacccaaaatacgctatcatcactgcaaactgtacttgtggtaac
gttatcaaagtaaactctactgctggtaaagatctgcatttagacgtatgtggtgcatgt
cacccattctacactggtacacaaaaagttgttgatacaggcggtcgtatcgacaaattc
aacaagcgcttcgcagtgcttgcaaagaaataa

DBGET integrated database retrieval system