KEGG   Shewanella baltica OS223: Sbal223_0720Help
Entry
Sbal223_0720      CDS       T00803                                 

Definition
(GenBank) periplasmic serine protease DegS
  KO
K04691  serine protease DegS [EC:3.4.21.-]
Organism
sbp  Shewanella baltica OS223
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sbp01002]
    Sbal223_0720
Enzymes [BR:sbp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Sbal223_0720
Peptidases [BR:sbp01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Sbal223_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 Trypsin PDZ_2 PDZ_6 PDZ Peptidase_S46
Motif
Other DBs
NCBI-ProteinID: ACK45239
UniProt: B8E9M4
Position
complement(858329..859411)
Genome map
AA seq 360 aa AA seqDB search
MTIKDTLLYLGKATLFGLIMAAMFLLVTRYFDNQSLGNSLLQTRANNTVELSFAKAVRRA
APAVVNIYSLSIDQNRPLNSGSLQGLGSGVIMSKEGYILTNYHVIKKADEIVVALQDGRK
FTSEVVGFDPETDLSVLKIEGDNLPIVPVNLDSPPQVGDVVLAIGNPYNLGQTITQGIIS
ATGRNGLSSGYLDFLQTDAAINAGNSGGALIDTNGSLIGINTAAFQVGEEGGGHGINFAI
PIKLAHSIMGKLIKNGRVIRGALGISGEPINPVVAQILNLPDLKGVLVTGVDPNGPAARA
LLMPRDVIIKYDGEDVPGVEMLMDRIAETTPGKKVMMTVIRQGKQQELPVIIDEKVVVDN
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacgataaaagacacactattatatctcggtaaagccacccttttcggtcttatcatg
gcggccatgtttttattggtaacccgttatttcgataaccaatccctcggtaatagcctg
ctacaaacccgagccaacaacacagtcgagctctcctttgccaaggcggtccgccgcgca
gcccctgcggttgttaacatttatagcctcagcatagatcagaaccgcccacttaactcg
ggttcgctacagggcctaggttctggggtgataatgagcaaagaaggctatattcttacg
aattatcatgtcattaaaaaggccgacgaaattgttgtcgccctgcaagatggacgcaaa
tttacctctgaagtggttggcttcgatccagaaaccgatttatcggtactcaagattgaa
ggcgataacttaccgattgtccccgttaacctcgacagtccgcctcaagtcggtgatgtc
gtgctcgccattggtaatccctacaatttaggccaaaccattacccaaggcatcataagt
gccacgggtcgtaacggcttaagttctggttacttagactttttgcaaaccgatgcggcg
attaatgccggtaactcgggcggcgcactcattgacactaacggcagccttatcggtatt
aataccgcagcattccaagtgggtgaagaaggcggcggccatgggattaacttcgctatc
ccaattaaattggcccacagcattatgggtaagttgattaagaatggccgcgtgatccgt
ggtgctttggggatttctggcgagccaattaaccctgttgtggcgcagatccttaatcta
cccgacctaaaaggtgtgctcgttacaggtgtcgatcctaatggccctgcggcgcgtgcc
ctcttaatgccaagggatgtaattattaaatacgatggtgaagatgtgccaggcgttgaa
atgctgatggaccgcatcgctgaaaccacaccgggtaagaaagtaatgatgactgtgata
cgccaaggtaaacaacaggagttacctgtgattatcgatgaaaaggttgtagtcgataac
tag

DBGET integrated database retrieval system