KEGG   Shewanella baltica OS223: Sbal223_1141Help
Entry
Sbal223_1141      CDS       T00803                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00240  Pyrimidine metabolism
sbp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sbal223_1141
Enzymes [BR:sbp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Sbal223_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N SLBB
Motif
Other DBs
NCBI-ProteinID: ACK45656
UniProt: B8E6P5
Position
1342473..1343804
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNGLALSSEEIQFFVQGITTNSVSEGQIAALGMAVYFNDMNMDERIALT
TAMRDSGTVLNWQSLGLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKDVGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLACNLDALAMDVKVGSGAFMPTYEASEELARSIAAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAIDFLTGAYRNPRLYEVTMGLCAEMLLLGGLASNEADARAKL
NRVLDNGRAAELFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADMQGYAYSMDTRELG
LAVVTLGGGRRKPGDALDYSVGLTQVCALGDKVDSSTPIAVIHAQSEAAFAEAELAVKKA
IHIGETAPEKTPEIYAYIRASDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagctcaagagattattcgtaaaaaacgtaatggtttagcgctaagttccgaa
gaaatacagttctttgttcaaggtattaccaccaactccgtatctgaaggtcagatcgcc
gcattaggcatggcggtgtattttaatgacatgaatatggatgaaagaatcgctttaacg
acagcaatgcgtgattctggcactgtgcttaattggcaatcattgggactcaacggtcca
gttatcgacaaacacagcactggtggtgtcggcgatgtgattagtctcatgcttggccct
atggctgcggcttgtggcggttatgtgcctatgatttctgggcgcggcctaggtcatact
ggcggtacactcgataagtttgatgccattccgggttaccaaacagagccttcaagtgaa
ttgttccgcaaagtggttaaagatgtcggggtggcgattattggccagacgggcgatctc
gttccagccgataaacgcttctattctattcgcgataataccgccaccgttgaatccatt
tccctcatcacagcatcgattttgtctaagaaattagcctgtaatttagatgcgttggcg
atggacgtaaaagtcggtagcggcgctttcatgccaacctatgaggcatctgaagaatta
gctcgcagtattgcagctgttgctaatggtgcgggtactaaaacgacggctttacttacc
gacatgaatcaagtgcttgcatcttgtgcaggtaacgcggttgaagtgaaagaagccatc
gactttttaacgggtgcttaccgtaacccgcgtttatatgaagtcactatgggtctttgt
gctgagatgctgctccttggcggtcttgcaagcaatgaagccgatgctcgcgctaaactg
aatcgtgtactcgacaatggtcgcgctgcagaactctttggcaagatggtgtcgggtctt
ggtggtccggttgattttgttgaaaactacagtaaatacctgccgcagtcacaaattatt
cgtcccgtctttgccgatatgcaaggttatgcctatagcatggatacccgtgagttaggt
ttagcggttgtgaccttaggtggcggccgccgtaagcccggcgatgcactagactatagt
gttggcttaacccaagtgtgtgccctaggcgataaagtggattcatcgacgccgattgcc
gttatccatgcacaatctgaagccgcgttcgcagaagctgaacttgcggtgaaaaaagcg
attcacattggtgaaaccgctccagaaaaaacacctgagatctatgcctatattcgtgca
tcggatctttaa

DBGET integrated database retrieval system