KEGG   Shewanella baltica OS223: Sbal223_1837Help
Entry
Sbal223_1837      CDS       T00803                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00020  Citrate cycle (TCA cycle)
sbp00310  Lysine degradation
sbp00380  Tryptophan metabolism
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
sbp01130  Biosynthesis of antibiotics
sbp01200  Carbon metabolism
Module
sbp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal223_1837
  09105 Amino acid metabolism
   00310 Lysine degradation
    Sbal223_1837
   00380 Tryptophan metabolism
    Sbal223_1837
Enzymes [BR:sbp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sbal223_1837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACK46342
UniProt: B8E769
Position
2169656..2170843
Genome map
AA seq 395 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FEEGATVLGEQVIAKFIAGAVSGKEVTKAQAEAATPAAETSDESSDALSPSVRRLLAEHN
VDASKVKGTGVGGRITKEDVEAFVKSAPKAAAPAPAVAPLAAGRSEKRVPMTRLRKTIAN
RLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYIKAVTEALKRFP
EVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMNLAEIEKAVRDLALKGRDGK
LTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMYL
ALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactaccagaatctgttgccgatgccacgattgcc
acttggcatgtgaaagtgggcgagcaagtttctcgtgatcaaaacctggttgatattgaa
accgataaagtggttcttgaagtggttgcgccagaagatggccacattggcgagtttttg
tttgaagaaggcgccactgttctgggtgaacaagtgatcgctaaattcatcgccggtgct
gtatctggcaaagaagtcactaaagcgcaagctgaagcggctacgcctgcagctgaaacc
agcgatgaaagcagtgatgcgttaagcccatctgtacgccgtttactggctgagcacaat
gttgatgccagcaaagtaaaaggcactggtgtgggtggtcgtattactaaagaagacgtt
gaagcttttgttaagtctgcgcctaaagcagcggcgccagcacctgctgtggctccatta
gcggctggccgtagcgagaagcgcgtgccaatgacacgtctgcgtaagacaatcgctaac
cgcttgttagaagcgaaaaactctaccgctatgctcaccacgtttaacgaagtgaacatg
aagccaatcatggatatccgtaagcaataccaagatatctttgaaaagcgtcacggtatc
cgtttaggctttatgtctttctacattaaagccgtgactgaagcgctgaaacgtttccct
gaagtgaacgcgtctattgatggcgatgatatcgtttatcacaactacttcgacatcagc
atcgcagtatcaacgccacgtggtctggtaacaccagtgttgcgtgacactgataccatg
aacttagctgaaatcgaaaaagcagttcgtgacttagcccttaaaggccgtgacggtaag
ctgactgtggctgacatgactggcggtaacttcactgtgactaacggtggtgttttcggt
tcactgatgtctacaccaattcttaacctgccacaaagcgcgattttaggcatgcatgcc
attaaagatcgcccaatggcagtcaatggtcaggttgaaatcctgcccatgatgtacctg
gcactctcatatgaccatcgtattgttgatggccgtgagtctgttggtttcttggtggcg
attaaagacttcctagaagacccaactcgtctgctgcttgatctgtaa

DBGET integrated database retrieval system