KEGG   Shewanella baltica OS223: Sbal223_1932Help
Entry
Sbal223_1932      CDS       T00803                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00340  Histidine metabolism
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01230  Biosynthesis of amino acids
Module
sbp_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Sbal223_1932
Enzymes [BR:sbp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Sbal223_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACK46437
UniProt: B8E9A4
Position
complement(2282810..2284111)
Genome map
AA seq 433 aa AA seqDB search
MEILTWSTLSTTEQKTALKRSPLIGDSGLEQSVRAILDAVATRGDAAIQEFNQKFDGFNS
AKIGELRMGEAEIAAASARVSPELKAAISKAMANIDVFHSAQQFRPIDMETEAGVRCELR
SEPIEKVGLYIPGGSAPLISTVMMLALPAKIAGCEQRVLVSPPPINDAIIYAANACGITE
IYQVGGAQAIAALAFGTETIPAVDKIFGPGNRYVTEAKRLVSQDGRCTVCIDMPAGPSEV
LVIADSDANCEFIAADLLSQAEHGPDSQVILVTDSQAIADGVNDALTRQLAVLPRCDIAA
TALLSSRTLVVDDMLQAAQVSNQYGPEHLIIQTRFPREVLKNIRAAGSVFLGAYTPESVG
DYASGTNHVLPTYGYSRAVSSLSLADFSRRFTVQELSAKGLIGLGQAVMTLASNELLDAH
KNAVAVRLASLEK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaacttggtcaaccttatcaaccaccgagcagaaaacggcgctgaaacgc
tcgcccttaattggtgacagtggcttagagcaaagtgttcgcgccattctcgatgcggtg
gcgacacggggtgatgccgccattcaagagtttaatcaaaaatttgatggcttcaatagc
gcgaagattggtgaactccgtatgggcgaagccgaaatagctgcggcaagcgcacgggta
tcgccagagctgaaagcagcgatatccaaagccatggcaaacatagatgtgtttcacagc
gcccagcaatttcgcccgattgatatggagaccgaggcgggagtacgctgcgaactacgt
agcgaaccgattgaaaaagtgggtttatatattcccggtggtagcgcgccattaatttct
accgtgatgatgcttgccctgcccgccaagatcgccggctgcgaacaaagagtattggtc
agcccaccgccgatcaacgatgccattatctatgctgccaatgcctgtgggatcactgaa
atctatcaagtgggcggcgcgcaggccattgcagcactggcctttggcacggaaacgatt
ccggcggtcgataagatttttggtcctggtaatcgctatgtgacggaagctaaacgctta
gtgtcacaggatggtcgctgcactgtgtgtatcgatatgccggctggcccttctgaggtg
ttggtgattgccgatagcgacgcgaattgcgaatttatcgccgccgatttgctttcacaa
gctgagcacggccctgattcacaagtgattttagtgacggattcgcaagctatcgcggac
ggcgtgaatgacgcactgacaagacaactcgccgtcctgccgcgttgtgatatcgcggca
acggcgctattgagcagtcgtactttggttgtggacgatatgctgcaagccgcgcaggtt
tccaatcaatatgggcctgagcacttgatcattcaaacgcgctttccccgtgaggtgctg
aaaaacattcgcgccgctggctcagtgtttttaggcgcttatacgcctgaatctgttggc
gattatgccagtggcaccaaccacgtgctgccgacttacggttacagccgcgccgtgtcg
agcctgtcattagccgactttagccgccgctttaccgtgcaggaactcagcgctaaaggc
ttaatcggactagggcaagctgtcatgacgttagccagcaacgaattgctcgatgcacac
aaaaatgccgtcgcagtacgtttagctagcctagagaaatga

DBGET integrated database retrieval system