KEGG   Shewanella baltica OS223: Sbal223_2434Help
Entry
Sbal223_2434      CDS       T00803                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00860  Porphyrin and chlorophyll metabolism
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
Module
sbp_M00121  Heme biosynthesis, glutamate => heme
sbp_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sbal223_2434
Enzymes [BR:sbp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Sbal223_2434
Exosome [BR:sbp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal223_2434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD DUF3502
Motif
Other DBs
NCBI-ProteinID: ACK46929
UniProt: B8E7H0
Position
2907372..2908355
Genome map
AA seq 327 aa AA seqDB search
MLNTPPLRRLRRLRSSEAMRDLLRETHISLSDLIHPLFIEEHITHAVPISTLPGISRLPE
SALADEVRELYALGIRYVMPFGISHTKDDKGSDAWDDNGLLARMVRTIKAAVPEMMVIPD
ICFCEYTDHGHCGVVHNNEVCNDLTVENLVKQSVTAAKAGADMLAPSAMMDGQVKAIRQG
LDATGFEHVAILAHSAKFASSFYGPFRAAVDCELSGNRKGYQLDYANGRQALLEASLDEA
EGADILMVKPGTPYLDVLSRLRQETHLPLAAYQVGGEYAGIKFAALAGALDERAVVTETF
VGLKRAGADLIVSYYTKQYAQWLAESR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacacgcctccattgcgtcgcctaagacgcttacgtagttcagaagcgatgcgc
gatctgctgcgcgaaacccatatttcgttaagcgatctcatccatcccctgttcattgaa
gagcacatcacccacgcagtgcctatctccacgctacctggtatcagccgtttaccagag
agtgcactggcggatgaagtgcgcgaactttacgccctcgggatccgttatgtaatgccc
tttgggatttcgcacactaaggatgataaaggcagcgacgcatgggatgacaatggcttg
ctcgcccgcatggtgcgcaccattaaagccgccgtgcctgagatgatggtgatccccgac
atttgtttttgtgaatacacagatcacggccattgcggcgtggtgcataataatgaagtc
tgcaacgatctcaccgtcgaaaatttagttaagcaatcagtcactgccgctaaagcgggc
gccgacatgctagcgccatcggccatgatggacggtcaagtgaaagccattcgccaaggg
cttgatgccacaggttttgagcatgtggcgattctggcccactcggcaaaattcgcctct
tccttctacggtcctttcagagcggcggtcgattgtgaactcagtggtaaccgcaaagga
tatcagcttgattatgccaacggtcgccaagccctgttagaagcctcattagatgaagcc
gaaggcgccgatatcctgatggttaaacccggtacgccctacttagatgtgttaagccgt
ttaagacaagaaacccacttaccactcgcagcctatcaagtcggcggcgaatatgcgggc
atcaagtttgcagcacttgcaggtgcgttggatgagcgtgcagtggtgactgaaacgttt
gtcggcttaaagcgggctggagcggatttgattgtcagctattacaccaaacagtacgcc
cagtggttagccgagagtagatag

DBGET integrated database retrieval system