KEGG   Shewanella baltica OS223: Sbal223_2532Help
Entry
Sbal223_2532      CDS       T00803                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00010  Glycolysis / Gluconeogenesis
sbp00620  Pyruvate metabolism
sbp00640  Propanoate metabolism
sbp00680  Methane metabolism
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
sbp01130  Biosynthesis of antibiotics
sbp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal223_2532
   00620 Pyruvate metabolism
    Sbal223_2532
   00640 Propanoate metabolism
    Sbal223_2532
  Energy metabolism
   00680 Methane metabolism
    Sbal223_2532
Enzymes [BR:sbp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sbal223_2532
Lipid biosynthesis proteins [BR:sbp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sbal223_2532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACK47026
UniProt: B8EAJ7
Position
3013901..3015853
Genome map
AA seq 650 aa AA seqDB search
MSSQSLYKVSGNIAANALVNNDKYKTMYQESIVNPEGFWREHGKRIDWIKPYTKIKKTSF
DDHNLSINWFYDGTLNASANCLDRHLAEHSDRVAIIWEGDNASEQRKITYGELHAEVCKF
ANALRSQGVRRGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKS
KVIITSDEGMRGGRAIPLKRNIDDALKNPDVTTVEKVIVLKRTGGKVDWVEGRDVWWHSL
METASEYCQPEEMDAEAPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKAGEV
YWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNHPSPARLGEMIDRHKVSILYTAPTL
IRALMAEGKQHFDKFDGSSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGG
ILITPLPGATDTKPGSATRPFFGVQPALVDNMGNILEGENEGNLVLLDSWPGQMRTVYGD
HERFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVSHE
LVAEAAVVGYPHDIKGQGIYAYVTLTRGTEETEELRQELRQWVRKEIGALATPDLIQWAT
GLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIESRLNRTE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcagtctctctacaaagtctccggcaatatcgctgccaatgcacttgtaaac
aacgataaatataaaacaatgtaccaagagtcgattgtcaatcccgaaggtttctggaga
gaacacggcaagcgtattgattggataaaaccctataccaaaattaaaaaaacctctttt
gatgatcataacttatcgatcaactggttttacgacggcaccctgaatgcttctgccaac
tgtttagatcgtcacttagccgagcacagtgatcgcgtggcgattatttgggaaggcgac
aacgccagcgaacaacgcaaaattacctacggtgaattacatgcagaggtgtgtaaattc
gctaacgcattacgcagccaaggcgtgcgccgcggtgacatagtcacaatttacatgcct
atggtgccagaagccgcagtggctatgcttgcctgtgcccgtatcggcgctgtgcactct
gtggtcttcggtggtttctcaccggattctatcgcctctcgcgtgattgatggcaaatca
aaagtcattattacctccgatgaaggtatgcgcggtggccgtgctattccattgaaacgc
aacatcgatgatgccttaaaaaatcctgatgtcactaccgttgaaaaagtcatcgtgctt
aaacgcacgggtggcaaagtggattgggtagaaggccgtgatgtgtggtggcactcattg
atggaaaccgcatctgagtactgccaaccagaggaaatggacgccgaagcgccgttattc
ctgctgtatacctcaggttcaaccggtaatcccaagggcgtattgcacaccactggcggc
tacatggtttatgcgtctatgacccatgagtatgtgttcgactacaaagcgggcgaagtg
tactggtgtaccgccgatgtgggttggatcactggccactcttacatggtttacggccca
cttgccaatggtgcgactgtgcttatccatgaaggcgttcctaatcatccaagccctgcc
cgtttaggcgaaatgattgaccgccataaagtgagtattctttacacggcaccaacctta
attcgcgcgctgatggccgaaggtaagcaacacttcgataagttcgatggtagcagcttg
aggatcatgggctcggtaggcgaacccatcaacccagaagcatggcgttggtaccatgag
gtcataggtcatgaacattgccctatcgtcgatacttggtggcaaactgaaaccggcggt
attttgattacgccactgcctggtgcgaccgatactaaacctggctcagcgacccgtccg
ttctttggcgttcaacctgccttagtcgataacatgggtaacattttagagggtgagaac
gaaggtaacttagtgttactcgactcttggcctggccaaatgcggactgtgtatggcgac
cacgaacgattcgtactgacctactttaaaactttccgcggcatgtattttaccggtgac
ggtgcccgccgcgatgaagatggttactactggataacaggccgagtcgatgacgtaatc
aacgtatccggccatagattaggtacggcagaggtcgaaagtgcgctggtatcacatgaa
ctggttgccgaggcagcagtagttggctacccacacgatattaaaggccaaggtatttat
gcgtatgtcacgctaacccgcggcactgaagaaaccgaagagctacgtcaagagctgcgt
caatgggttcgtaaagaaattggtgcgctggcaaccccagatctcatccaatgggcgacg
ggcttacctaagacacgttcgggcaagatcatgcgccgcttcctgcgtaagattgccgct
aacgaagtgaccaacttaggggatgcatcaaccttggccgatccagctgtgatcgagacc
ttgattgaatcacgcttaaatcgtacagagtaa

DBGET integrated database retrieval system