KEGG   Shewanella baltica OS223: Sbal223_2856Help
Entry
Sbal223_2856      CDS       T00803                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00071  Fatty acid degradation
sbp00072  Synthesis and degradation of ketone bodies
sbp00280  Valine, leucine and isoleucine degradation
sbp00310  Lysine degradation
sbp00362  Benzoate degradation
sbp00380  Tryptophan metabolism
sbp00620  Pyruvate metabolism
sbp00630  Glyoxylate and dicarboxylate metabolism
sbp00640  Propanoate metabolism
sbp00650  Butanoate metabolism
sbp00900  Terpenoid backbone biosynthesis
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
sbp01130  Biosynthesis of antibiotics
sbp01200  Carbon metabolism
sbp01212  Fatty acid metabolism
sbp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal223_2856
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal223_2856
   00640 Propanoate metabolism
    Sbal223_2856
   00650 Butanoate metabolism
    Sbal223_2856
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sbal223_2856
   00072 Synthesis and degradation of ketone bodies
    Sbal223_2856
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sbal223_2856
   00310 Lysine degradation
    Sbal223_2856
   00380 Tryptophan metabolism
    Sbal223_2856
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sbal223_2856
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sbal223_2856
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sbal223_2856
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbp04147]
    Sbal223_2856
Enzymes [BR:sbp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sbal223_2856
Exosome [BR:sbp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal223_2856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACK47342
UniProt: B8E7M0
Position
complement(3357057..3358247)
Genome map
AA seq 396 aa AA seqDB search
MSTEQLNQDIVIVAAKRTPMGGFQGNLSSVASPMLAATAIKGLLAETQLAGEHVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGG
MESMSQAPYLLDKARGGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQ
MDAFALSSLEKANAAINSGAFKTEITPVTVSDRRGDVTIDTDEQPGNARPEKIPTLRPAF
TKDGTITAANSSSISDGAAALMLTSRGEADRLGLAVLATIKGHTTHAQEPSLFTTAPVGA
MAKLLANVGWSTDEVDLFEINEAFAMVTMLAVSELGLDIAKVNVNGGACALGHPIGCSGS
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacagttaaatcaagatatcgttatcgttgctgctaaacgcaccccaatg
ggcgggtttcaaggcaacttatcatccgtagcatcacccatgttagccgcgacggccatt
aaaggcttgttagcggaaacacaattggcgggtgagcatgtcgatgaagtcttgatgggc
tgcgtattacccgcaggtttaggccaagcgcctgcacgtcaggcaactttgggtgcggga
ttacccttatccgttggtgcgaccacagtgaacaaggtctgtggctcaggcatgaagacg
gtaatgttagcccacgatttgattaaagcgggcagtgcaaaagtggtgatcgcaggcggc
atggaaagcatgagccaagcgccgtatttactcgataaagcccgcggcggcatgcgcatg
ggccatggcaaagtgttagatcacatgtttttagatggtcttgaagatgcctacacgggt
ggtgctatgggaacgttcgcccagaaaacggccgatgaatttggtatcacccgcgagcag
atggacgcttttgccctaagctcgctcgaaaaagccaatgccgcgattaactcgggtgcc
tttaaaactgaaatcacccccgtcacagtcagtgatcgtcgtggtgatgtgactatcgat
accgacgagcaacccggtaatgcccgccctgaaaaaattcctacactgcgcccagccttt
actaaagatggcactatcacagcggcaaactctagctctatttccgatggtgcagcggca
ttaatgttgacctcgcgcggcgaagctgaccgtttaggtttagccgtgttagctactatt
aaaggccatacaacccacgcccaagagccttcattgttcaccactgcaccggttggcgct
atggcgaaattgctggccaatgtcggttggtcaacggacgaggtggatttattcgaaatc
aatgaagccttcgccatggtgactatgcttgctgtgtctgagctaggtttagatatcgct
aaggtaaacgttaatggcggcgcctgcgccttaggtcatccgattggttgctcgggttca
cgtttactggtgaccttaattcatgcattgaaagcccgcggcttgaagcgcggtgttgcc
tcgctgtgtatcggcggtggtgaagcgacggcgatggccattgaggtttaa

DBGET integrated database retrieval system