KEGG   Shewanella baltica OS223: Sbal223_2868Help
Entry
Sbal223_2868      CDS       T00803                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00360  Phenylalanine metabolism
sbp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sbp00790  Folate biosynthesis
sbp01100  Metabolic pathways
sbp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Sbal223_2868
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal223_2868
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal223_2868
Enzymes [BR:sbp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Sbal223_2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ACK47354
UniProt: B8E7N2
Position
complement(3368192..3368992)
Genome map
AA seq 266 aa AA seqDB search
MTKGTEYIAHRADDTGFIHYPQEEHDIWRQLYARQAVNLPGRACKEYLQGLDALGMPKDR
IPQLAEIDAVLQATTGWKTAAVPALISFGRFFELLANKEFPVATFIRRKEEFDYLQEPDI
FHEIFGHCPLLTNPSFANFSHMYGQLGLHASKEERVFLARLYWFTVEFGLLQPKDGPLCI
YGGGILSSPGETLYAMESDAPERQPFDLLNVLRTPYRIDIMQPIYYVIEHIDMLDEIAKM
DIMAYVTKARQLGLFAPKFPPKAKAS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaggaacagagtacatcgctcacagagccgatgacactgggtttatccattac
ccacaagaagagcacgatatttggcgtcagctttacgcccgtcaagccgttaatctcccc
ggtcgtgcctgcaaggaatatctgcaagggctcgatgccttgggtatgccaaaggatcgc
attccgcaacttgccgaaattgatgcggtattacaagcgaccactggctggaaaacggcg
gcggtacctgcgctgatttccttcggccgtttttttgaattactggccaataaagagttt
cctgtggccacctttattcgccgcaaggaagagtttgattacttgcaagagccagatatc
ttccacgagatttttggtcactgccctttgctcaccaacccttcatttgccaatttctct
cacatgtatgggcagttaggtttacatgccagcaaagaggaaagggtatttttagcgcgt
ttgtactggtttacggttgagtttggtttactacagcctaaagacggtcccttatgtatt
tatggcggcggcattttaagctcacccggtgaaaccttgtatgcaatggaaagtgacgcg
ccagaacgtcaaccttttgatttattgaatgtgctgcgaaccccatatcgcatcgacatt
atgcagccgatttattatgtgattgagcacattgatatgctggatgaaattgccaagatg
gatattatggcttatgtcactaaggcccgtcagttaggtttatttgcccctaagtttccg
ccaaaagctaaggcgagttaa

DBGET integrated database retrieval system