KEGG   Shewanella baltica OS223: Sbal223_2948Help
Entry
Sbal223_2948      CDS       T00803                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00010  Glycolysis / Gluconeogenesis
sbp00052  Galactose metabolism
sbp00500  Starch and sucrose metabolism
sbp00520  Amino sugar and nucleotide sugar metabolism
sbp00521  Streptomycin biosynthesis
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
sbp01130  Biosynthesis of antibiotics
sbp01200  Carbon metabolism
Module
sbp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal223_2948
   00052 Galactose metabolism
    Sbal223_2948
   00500 Starch and sucrose metabolism
    Sbal223_2948
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal223_2948
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sbal223_2948
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sbal223_2948
Enzymes [BR:sbp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sbal223_2948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ACK47434
UniProt: B8E7W2
Position
3474908..3475750
Genome map
AA seq 280 aa AA seqDB search
MSVLCLDLGGTKLMLAQVEGKTLLDTWRYPVPADGNFEQLLDFLVTCIHSHLTPETYGIS
IGIPGMVDMHSGTLLEVLNIPALTATQLAQQLKNTFEMDVVVNNDANLFALGEAVLNRNQ
DMLGITLGTGVGAGVIFNGQLYSGKHCAAGEIGSLSYRDGIIEHYCSGQYFTTHHHMSGE
YLYQKACEGDSQALQAFAHFGEHLAHMIAQTLLIYDPKDIVLGGSVSQSFPFFIEALKQK
LQSLVYGPQLADLTISASQHHNAALIGAAQWFLQQKDLAK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcctatgtttagatcttgggggaactaaactgatgttggcacaggtggaaggt
aaaaccttactcgacacttggcggtatcccgttcccgccgatggcaatttcgaacagtta
ctcgatttcctcgtgacctgtatccacagccacctcacgcctgaaacctatggtatttcc
atcgggatacccggcatggtggatatgcacagcggcaccttactcgaagtgctcaacatc
cctgcgttgacggcaacgcagttagcccagcaacttaaaaatacctttgaaatggatgtt
gttgtgaataacgacgctaacctctttgcccttggcgaagctgtgctcaatcgcaatcaa
gacatgctcgggattaccttaggcacaggcgtgggcgctggggtgatttttaatggtcag
ttgtattcgggtaaacattgcgccgcaggagaaatcggcagtttgagttatcgcgatggc
ataattgagcactattgctcggggcaatacttcaccactcaccatcacatgagtggcgaa
tatttgtatcaaaaagcctgtgaaggagacagccaagcgctgcaagccttcgcccatttt
ggtgaacacttagcgcacatgatcgcccaaaccttactgatatacgatcccaaagatatc
gtccttggcggctcagtcagccaaagctttcccttttttattgaagcgcttaaacagaaa
ttgcaaagcttagtctatggcccccaactggcggacttgacgatttcagccagccaacat
cacaatgcggcactcattggcgccgcgcaatggtttttacaacaaaaggacttagctaag
tga

DBGET integrated database retrieval system