KEGG   Shewanella baltica OS223: Sbal223_3043Help
Entry
Sbal223_3043      CDS       T00803                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00620  Pyruvate metabolism
sbp00630  Glyoxylate and dicarboxylate metabolism
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
sbp01200  Carbon metabolism
Module
sbp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal223_3043
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal223_3043
Enzymes [BR:sbp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal223_3043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACK47528
UniProt: B8EAY6
Position
complement(3604216..3605865)
Genome map
AA seq 549 aa AA seqDB search
MTEHTLSEQQLNSTLGKATANATLNIVGRDIPGQEVIFTEGAVALLESLCREFADEVPAL
LAKRKDKQARIDKGSLPDFLPETRAIRDGAWQIRGIPDDLLDRRVEITGPVERKMVINAL
NANAKVFMADFEDSLAPSWEKVVEGQINLRDAVRGDIEYTAPDTGKHYKLGPNPAVLICR
VRGLHLKEKHVQFNGKAIPGSLFDFALYFYHNYRQLLAKGSGPYFYIPKLESHVEARWWA
KVFAFVEERFCLQAGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKT
LKRHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPVQNEAVL
QRVRRDKELEARNGHDGTWVAHPGLADTAMGIFNEYIGQDHCNQLHITRDVDAPILASEL
LKTCDGERTEQGMRLNIRIALQYLEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHG
KSLSNGKLVTKQLFKDMLVEELSNVKKEVGSDRFTHGKFTQAAVLLEDITTSDELVDFLT
LPGYEMLTA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacacactttgagtgaacagcaattgaattcgacactgggtaaagctacagca
aacgccacgcttaatattgtgggtcgtgacattccaggccaagaagtcatctttaccgaa
ggggctgtcgccttactcgaatccctttgtcgtgagtttgccgacgaagtacccgcctta
ctcgctaaacgtaaagataagcaagcgcgtatcgataaaggatcattacccgactttctg
cctgaaacccgcgctattcgtgatggtgcatggcaaattcgcggtattcccgatgacttg
cttgaccgccgcgtggaaatcacaggtcccgttgaacgtaagatggtgattaatgcactc
aacgccaatgccaaagtgtttatggccgatttcgaagattctttagcaccaagctgggaa
aaagtcgtcgaaggtcaaatcaatctacgtgatgccgtgcgtggtgatattgagtacaca
gcaccggacacaggtaagcactacaaattaggaccaaatccggcggtgcttatttgccgc
gttcgtggtctgcaccttaaagaaaaacacgtgcagtttaacggcaaagcgattcctggc
tcactgtttgatttcgcactgtatttctaccacaactatcgccaacttttggccaagggc
agtggtccatacttttatattcctaagttagaaagtcatgttgaagcgcgctggtgggca
aaagtatttgcttttgttgaggaaaggttttgtctgcaagcgggcacgattaaatgtact
tgcctgatcgagacgttaccggccgtgttcgaaatggacgaaatcctctacgagctgcgt
tccaatatcgtcgcgctgaactgtggtcgctgggattacatcttcagctatatcaaaaca
ttaaagcgtcatagcgaccgtgttttaccggatcgccaagccgtcactatggatacgcct
ttcttaagtgcttattcaagactcttgattaagacctgccacaaacgcggtgcgttagcg
atgggcggcatggcggcctttattccagctaaagatccggttcagaacgaagcggtattg
cagcgagttcgtcgagataaagagctcgaggcgcgtaacggccacgatggcacttgggtg
gcacaccctggtcttgccgataccgctatgggtattttcaacgaatacataggtcaagat
cactgtaatcaattgcatattacccgtgatgtcgatgcgccaatcctggctagcgaactg
cttaaaacctgcgacggtgagcgcaccgaacaggggatgcgtctgaacattcgtatcgca
ctgcagtatttagaggcttggatcagcggcaacggttgcgtacctatttacggcttaatg
gaagatgcagctacagctgagatttctagagcctcaatttggcaatggatccaacacggt
aagtcgctgtcaaacggcaaactcgtgaccaagcaactctttaaagacatgttggttgaa
gagctgtcgaacgtgaaaaaagaagtgggtagcgacagattcacccatggcaaattcacc
caagcggcggtattgctcgaagacattaccacctccgacgagctggtcgatttcttaacc
ttacccggttacgaaatgctgactgcctag

DBGET integrated database retrieval system