KEGG   Shewanella baltica OS223: Sbal223_3314Help
Entry
Sbal223_3314      CDS       T00803                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
sbp  Shewanella baltica OS223
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Sbal223_3314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ACK47798
UniProt: B8EB36
Position
3933967..3934347
Genome map
AA seq 126 aa AA seqDB search
MSALDTSIRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWIITDANGNT
SEVQGAGVVGETPTIAPNTAYQYTSGTVLDTPLGIMHGTYGMVSESGEHFQATIRPFRLA
TPGLLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattggacacctccattcgggttgaagttaaaactgaatatatagagcagcag
tcctcgcccgaggatgaaaaatacctcttcagctataccatcactatcatcaatttaggt
gagcaggcggctaaactcgaaacccgtcactggataatcacagatgccaatggcaatacc
agtgaagtccaaggcgccggagttgtcggtgaaacaccaaccatagcgccaaataccgcc
tatcaatacaccagtggcacagtgctcgatacaccccttggcataatgcatggcacttat
ggtatggtcagcgaatcgggtgagcatttccaagcgacgatccgtcccttccgtttagcg
acccctggcttactacattaa

DBGET integrated database retrieval system