KEGG   Shewanella baltica OS223: Sbal223_4432
Entry
Sbal223_4432      CDS       T00803                                 
Name
(GenBank) type-F conjugative transfer system pilin assembly protein TraF
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
sbp  Shewanella baltica OS223
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbp02044]
    Sbal223_4432
Secretion system [BR:sbp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sbal223_4432
SSDB
Motif
Pfam: TraF T2SSC DUF3452
Other DBs
NCBI-ProteinID: ACK48888
UniProt: B8EFU7
Position
pS22302:complement(19040..19915)
AA seq 291 aa
MRTLLNNRLQHAAASPFFRWSSRAPLAWLSTKNGDAVVNKRSALVLLMLTTFCHGANATD
AQGWRWYNEPTAPKKQAPKKAETPSVTLTRTKTLTPTEQMDWFHSYYQDTLNDAAINSQD
SEKVEKAMLLNQYVSNKSSEFGMTFKKVLLDNPELSYTKDRPTEQAARSTYLSLERNKKM
RAVRSLADAGWGLFFVYKGQEEMDIALAPSVQQFATEHGIELLGVTLDGVALPAIVQNRQ
NDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRFLNVATDFAPDF
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaggacgttgttaaataaccgcttacaacatgccgcagcatctcctttttttcggtgg
tcaagccgcgcgccgttggcgtggttgtccacaaaaaatggggatgcagtggtcaacaag
cgcagcgcgttagtgctccttatgctgacaacgttttgccacggtgcaaacgccacggat
gcacaagggtggcgctggtataacgaaccgacagcccccaagaagcaagcgcctaaaaag
gccgaaacgccaagcgtcacactcacgcgcaccaaaacgctgacgcccaccgagcagatg
gattggttccacagctactaccaagacacgctcaatgacgcggcgataaacagccaagac
agcgagaaagtggaaaaggccatgctgcttaatcagtacgtcagtaataaatcgtcagag
tttggcatgaccttcaaaaaggtcctgctggataaccctgagctgtcttacaccaaagat
agaccgacggaacaagcggcaagaagcacctatttatcattagagcgcaacaagaagatg
cgcgcagtacgcagccttgccgatgcgggatgggggctgttctttgtctacaaaggccaa
gaagaaatggatattgcgctagcgcccagcgtgcagcaattcgctactgagcatggcatt
gagctacttggcgtcacgctcgatggtgtagcactgccagccatcgtgcagaaccgccaa
aacgaccagcacataaacgtcccgtttagtcccgcactcgtgttagttaatcctggcacg
ggggaaatgaaaccgctcgcgtatggctttatctctcaagacgatttactgggccgtttc
ctgaacgtggccaccgatttcgcccctgacttttaa

DBGET integrated database retrieval system