KEGG   Shewanella baltica OS223: Sbal223_4438Help
Entry
Sbal223_4438      CDS       T00803                                 

Definition
(GenBank) type-IV secretion system protein TraC
  KO
K12063  conjugal transfer ATP-binding protein TraC
Organism
sbp  Shewanella baltica OS223
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbp02044]
    Sbal223_4438
Secretion system [BR:sbp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sbal223_4438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraC_F_IV AAA_10 TrwB_AAD_bind DUF87 Pox_A32 ABC_tran AAA_30 APS_kinase AAA_29 FtsK_SpoIIIE
Motif
Other DBs
NCBI-ProteinID: ACK48894
UniProt: B8EFV3
Position
pS22302:complement(24563..27151)
Genome map
AA seq 862 aa AA seqDB search
MKQRIKNDLGALYASSKQQHNHLHHELPYRIYDDAEQVFENANSLGFGFAISLFGGANDD
LIKTMNALVCTLPEGDKWHYQFVMVGNNQVGELIEQNQALLSGRNAICDKFASNEAIYAK
HSSTKGFGTKLSSAYHYDLKNTKGFFFVSTTEDMPALLDMRLGIESELAQTGMHIRRLGA
DDLIEHCREHLNFSHQQDRVSPAKYNEYQPLNTQILSPDSEFIINRDSVNIRHTPMQSDN
SVDTTLINLGLKGLPNDFRLYAFPNCIASLSYTMNSVQCPYRVSVSFYINKTGEQTTRND
SKIGSLTKTVNSPMRLLIPSAADELAERKEIQKGLSSHAFKITTMTLNVTLYTTEEKHRH
DTSKAIATFRTAGIDLIRNNKLQGMCTLSTLPFSMSEGFMKDSQKAGLCFMMKTSNLVNF
LPIVADYKRLSAGLLLPTMRHQISYFDPFNCGSDNYNMAITGGSGAGKSFFMQALVKSIF
AKGGKAWILDKGQSYKKLTQTLGGVYLDSSQIFLNPFTHLGKVLSVRDAGTFGPILDDEG
QAIDPITEVLGNITALIATMASPDEKLTGFQTALLGDAILLAWQKCGNDTLIDDVQKALY
DIAAQKNDDTRISDIAAQLNKFCSSGIHGAIFNKPSMLDPNIDITTLELDGFKGELQRPV
IFALMVTISQQMYLSGQRSIPKICVIEEAWSLMSGANAQSKDFINEGYRTVRKFGGSFAT
VTQGMNDFFANAEAEAALNSSDIHITLRQGDGFGDFLNKHPDHFSPFEQHMIKSFPRAND
AGHSCVMLKAGGLVSFHRIFADPWSRAMLSTEPKEFEHCENLIKGGMPLLDAIELTAQHF
YPDDMARFDAILSAAATHKEAA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacgtattaaaaacgatctcggcgcactctatgccagcagcaaacagcaacac
aaccatctgcatcatgaattgccctatcgcatttatgatgatgctgaacaagtctttgaa
aatgctaattcgcttggttttggctttgccatttcgctgtttggcggggctaatgacgac
ttaatcaaaaccatgaacgccttggtgtgcacactgccagagggcgacaaatggcattat
caattcgtcatggtcggtaataatcaagtcggtgagctcatcgagcaaaatcaagcgctg
ctcagtggccgcaatgccatttgcgataaatttgcctcaaatgaagctatctatgcaaaa
cacagttcgaccaaaggctttggcaccaagctcagcagcgcatatcactacgatctaaag
aacactaaagggtttttctttgtgtcaaccaccgaagatatgcccgcactgctggatatg
cgtcttggcattgaatcagagctggcgcaaacaggcatgcacattcgccgcttaggcgct
gacgatctgattgagcattgccgcgagcatttaaatttttcgcatcaacaagatcgcgtt
tcgcccgctaaatataacgagtatcaacctctcaacacccaaatcctcagccctgacagt
gagttcatcattaaccgtgattcggtcaatatccgtcacacaccgatgcaatcagacaac
agtgtcgataccaccttaatcaatcttgggctaaaggggctgccgaacgactttaggcta
tatgcgtttcccaactgtattgcatcactcagttacaccatgaacagtgttcaatgccct
taccgtgtcagcgtgtctttttatattaataaaacgggtgagcaaacaacccgtaacgac
agcaaaattggatctttgaccaaaacggtcaactcccctatgcggttgttaatccccagt
gccgcggatgaactggctgaacgcaaggagatacaaaaaggactcagctcacacgccttt
aaaatcaccaccatgacattgaatgtcaccctgtatacgacagaagagaagcaccgccac
gacacctcaaaggcgattgcgacatttcgcacggcaggcattgatttaatccgaaacaat
aaactgcaaggcatgtgcacactgtccaccctcccgttctcaatgagcgaaggctttatg
aaagacagccaaaaagcgggcctgtgtttcatgatgaaaacctcaaacttggtgaacttt
ttaccgattgttgcagactacaaacgcttatccgcagggttactcttgccaacaatgcgc
catcaaattagctatttcgatccgtttaactgcggcagtgataactacaacatggccatc
acgggcggctcaggggcagggaagtcattcttcatgcaagccttggtaaaatcgattttt
gccaaagggggcaaggcatggattcttgacaagggtcagagttacaaaaaactcactcaa
acattaggcggcgtctatctcgatagttcgcagattttcctaaacccgtttacccactta
ggcaaagttttaagcgtgcgggatgcgggtacttttggccctatcctcgatgatgaaggt
caagccattgatcccatcaccgaagtgttgggaaacatcaccgcgcttatcgccaccatg
gcatcacctgatgaaaagctcaccggatttcagacggcattactcggcgatgctattttg
ctggcatggcaaaaatgcggtaacgacacgctgattgacgatgtgcaaaaggcactctat
gacattgccgcacaaaaaaatgacgatacccgtatcagtgatatcgctgcgcaattaaac
aagttctgttcaagcggtattcatggcgcaattttcaataagccctcgatgctcgatccc
aatattgacattaccacgctggaacttgatggatttaaaggcgagctacaacgtccggtg
attttcgcgttgatggtgacgattagccaacaaatgtacttatcgggccaacgttctatt
ccgaaaatctgtgtgattgaagaagcgtggtcactcatgagcggcgcgaatgcgcaaagt
aaggatttcatcaacgaaggttatcgcacagtgcgtaagttcggcggcagctttgccaca
gtaacgcaaggcatgaacgacttctttgccaacgccgaggccgaagcggcactgaacagt
tcagatattcatatcaccttgcgccaaggtgatggctttggggatttcttgaacaagcat
cctgaccacttctcgcccttcgagcaacacatgatcaagtcattcccccgcgccaatgat
gcgggtcattcctgcgtgatgctcaaagcgggcgggctagtgtcctttcaccggattttt
gccgatccatggtcgcgcgccatgctctcaaccgagccgaaagaatttgagcattgtgag
aaccttattaaaggcggcatgccgttactcgatgccattgaactgacagcccaacatttc
tatcccgatgatatggctcgttttgatgccattttgtccgcagcagcaacccacaaagag
gccgcataa

DBGET integrated database retrieval system