KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028003Help
Entry
101028003         CDS       T04350                                 

Gene name
DCHS1
Definition
(RefSeq) protocadherin-16
  KO
K16507  protocadherin-16/23
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    101028003 (DCHS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:sbq04515]
    101028003 (DCHS1)
Cell adhesion molecules [BR:sbq04515]
 Cadherins
  Cadherin related
   101028003 (DCHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_3 Cadherin_4 Big_9
Motif
Other DBs
NCBI-GeneID: 101028003
NCBI-ProteinID: XP_003919814
UniProt: A0A2K6SZ65
Position
Unknown
AA seq 3297 aa AA seqDB search
MQEELGIVPSCPGMKSPRPRLLLRLLLLLLLLGAGVPGAWGQAGSLDLQIDEEQPAGTLI
GDISAGLPAGTAAPPMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDRERRDRYRFTAVT
PDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPAHDADAGRLGTQGYA
LSGDGAGETFRLETRPGPDGAPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALL
DVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGANGAVTYEINRRQSEG
DGPFSIDAHTGLLRLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPS
MTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVI
YLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEP
LPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHSHWFSIDPTSGIITTAVSLDYELE
PQPQLIVVATDGGLPSLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVT
ATDADSGPFGLLSYSLGAGLGASGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVD
GGGLKSMVYVKVFLSDENDNPPQFYPREYATSLSAQSPPGTAVLRVRAHDPDQGSHGRLS
YHILAGNSPALFALDEQSGLLTVAWPLARRANSVVQLEIGAQDGGGLQAEPSARVNISIV
PGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLALSGGDPRGLFSLDA
VSGLLQTLCPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTV
LLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSGG
PAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFDSPTYRVDLPSGTIPGTQVLQ
VQAQAPDGGPITYHLAAEAASSPFGLEPQSGWLWVRAALDREAQELYTLKVMAVSGSKAE
LGQQTGTATLRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLT
YSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPSRSTTGTVHVAV
LDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGS
ELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLTEPP
PDSTERDPAAPLPVVLTVTAAEGLRPGSLLGSVAPPEPVGVGALTYTLVGGADPEGTFAL
DAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVRVQDENEHAPTFARDPL
ALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGL
DRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPG
PAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDRERRAEHVLTVVA
SDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENSPPGTSLLTLRATDPDLGAN
GQVTYGGVSSESFSLDPDTGVLKTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAV
EDENDHAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLD
LASGEFGTMRPLDREVEPAFQLKIEARDGGQPALSATLLVTVIVLDANDHAPAFPVPAYS
VEVPEDVPAGTLLLQLQAHDPDAGANGRVTYYLGAGTAGAFLLEPSSGELRTAAALDREQ
CPSYTFSVSAVDGAAAGPLSTTVSVTVTVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTL
ALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFVVAT
DLGRPARSATGVIIVGLQGEAERGPRFPRASSEAMIRENAPPGTLIVSPRAVHAGGSNGP
ITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFSVLTLTL
QDANDNAPRFLRPHYVAFLPESRPFEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFH
VDPATGIITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQPW
ELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQ
CDHYQLQLLAHDGPHQGHANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSAT
DRDSGANGHISYHLASPADGFTVDPNNGTLFTIVETVALGHEGSGAVDVVLEARDHGAPG
RAARATVHVQLQDQNDHAPSFTLPHYRVAVTEDLPPGSTLLTLEATDADGSRTHAAVDYS
IVSGNRGQVFQLEPRLAEAGEGSGPGPRALGCLVLLESLDFESLTQYNLTVAAADRGQPP
RSSVVPVTVTVLDVNDNPPVFTQASYRVAVPEDTPVGAELLHVEASDADPGPHGLVHFAV
SSGDPSGLFELDENSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVND
HGPAFPLNLLSTSLAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALN
SSTGELRARMPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQ
VPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLQVDSRAPGSGT
ATSEGGGRTRREAPRELRLEVVARGPLPGSRSATVPVTVDITHTALGLAPDLNLLLVGAV
AASLGVVVVLALAALVLGLVRARSRKAEAAPGPMSQAAPLASGSLQKLGREPPSPPPSEH
LYHQTLPSYGGPGAGGPYPRGGSLDPSHSSGRGSAEAAEDDEIRMINEFPRVASVASSLA
ARGPDSGIQQDADGLSDTSCEPPAPETWYKGRKAGLLLPGTGTTLYREEGPPTTATAFLG
GCGLSPAPTGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLASVFT
EIARLKDEARPCPPAPRIDPPPLITAVAHPGAKSVPPKPANTAAARAIFPPASHRSPISH
EGSLSSAAMSPSFSPSLSPLAARSPVVSPFGVAQGPSASALSAESGLEPPDDTELHI
NT seq 9894 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaagagctgggcattgtgccttcctgccctggcatgaagagccccaggccccgc
ctcctcctacggttgctgctgctgctgctgctgctgggggctggggtgccaggtgcctgg
ggtcaggctgggagcctggacttgcagattgatgaggagcagccagcaggtacactgatt
ggggacatcagtgcggggctaccggcaggcacggcagctcctcccatgtacttcatctcc
gcccaggagggcagcggcgtgggcacagacctggccattgacgaacacagtggggtcgtc
cgcacagcccgagtcttggaccgtgagcggcgggaccgctaccgtttcactgcagtcact
cctgatggtgctactgtagaagttacagtgcgagtggctgacatcaatgaccatgctcca
gccttcccacaggctcgggctgccttgcaggtacctgagcatacagcttttggcacccgc
tacccactggagcctgctcatgatgcagatgctgggcgtctgggaacccagggctatgcg
ctatctggtgatggggctggagagaccttccggctggagacacgcccgggtccagatggg
gctccagtgcctgagctggtagtcactggggagctggaccgagaaaaccgctcacactat
atgctacagctggaggcctatgatggtggttcacctccccggagagcccaggccctgctg
gatgtgacactactggacatcaatgaccatgcccctgctttcaatcagagccgctaccac
gctgtggtgtctgaaagcctggcccccggcagtcctgtcttgcaggtgtttgcatctgat
gccgatgctggtgccaatggggctgtgacttacgagatcaaccggaggcagagcgagggt
gacgggcccttctccatcgacgcacacacggggctgctgcggctagagcggccactggac
tttgagcaacggcgggtccatgaactggtggtgcaagcacgagatggtggggctcaccct
gagctgggctcggctttcgtgactgtgcatgtgcgagatgccaatgacaatcagccctcc
atgactgtcatcttcctcagtgcagatggctccccccaagtgtctgaggctgctccacct
ggacagctcgttgctcggatctctgtgtcagacccagatgatggtgactttgcccacgtc
aatgtgtctctggaaggtggagagggccactttgccctaagcacccaagacagcgtcatc
tatctggtgtgtgtggctcggcggctggatcgggaggagagggatgcctataacttgagg
gttacagccacagactcaggctcacctccactgcgggccgaggctgcctttgtgctgcac
gtcactgatgtcaatgacaatgcacctgcctttgaccgccaactctaccgacctgagccc
ctgcctgaggttgccctgcctggcagctttgtggtacgggtgactgctcgggatcctgac
caaggcaccaatggtcaggtcacctatagcctagctcctggtgcccacagccactggttc
tccattgaccccacctcaggcattatcactacagctgtctcactggactatgagttggaa
cctcagccacagctgattgtggtggccacagatggtggcctgccttctctagcctcctct
gccacagttagcgtggccctgcaagatgtgaatgataatgagccccagttccagaggact
ttctacaatgcctcgctgcctgagggcacccagcctggaacttgcttcctgcaggtgaca
gccacagacgcagatagtggcccatttggcctcctctcctattccttgggtgctggcctt
ggggcctccggatctcccccattccgcattgatgcccacagcggtgatgtgtgcacaacc
cggaccctggaccgtgaccaagggccctcgagctttgacttcacagtgacagctgtggat
gggggaggcctcaagtccatggtatatgtgaaggtgtttctgtcagatgagaatgacaac
cctcctcagttttatccacgggagtatgctacgagtctaagtgcccagagtccaccaggc
acagctgtgctgagggtgcgtgcccatgaccctgaccaggggtcccatgggcgactctcc
taccatatcctggctgggaatagccctgcactttttgccttggatgagcaatcagggctt
ttgacagtagcctggcccttggccagacgggccaactctgtggtgcagctggagatcggg
gctcaggatggaggtggcctacaggcagaacccagtgcccgagtgaacatcagcattgtg
cctggaacccccacaccacccatatttgagcaactacagtatgttttttctgtgccggag
gatgtggcaccaggcaccagtgtgggcatagtccaggcacacaacccaccaggtcgtttg
gcacctgtgacccttgccctatcaggtggggacccccgaggactcttctccctagatgcg
gtttcagggttgttgcaaacactttgccccctggaccgggagctactgggaccagtgctg
gagctggaggtgcgagcaggcagtggagtgcccccagctttcgctgtagctcgggtgcgt
gtactgctggatgatgtgaatgataactcccctgcctttcctgcacctgaagacacggta
ttgctaccaccaaacactgccccagggactcccatctatacactgcgggctcttgaccct
gactctggtgttaacagtcgagtcacctttaccctgcttgctgggggtggtggagccttc
actgtggaccccaccacaggccatgtacggcttatgaggcctctggggccctcaggaggg
ccagcccatgagttggagctggaggcccgggatgggggttccccaccacgcaccagccac
tttcgactacgggtggtggtacaggatgtgggaacccgtgggctggctccccgattcgac
agccctacctaccgtgtggacctgccctcaggcaccatccctggaactcaggtcctgcaa
gtgcaggcccaagcaccagatgggggccctatcacctatcaccttgcagcagaggcagca
agtagcccctttggcctggagccacagagtgggtggctatgggtacgggcagcactggac
cgtgaggcccaggagttgtacacactgaaggtaatggcagtgtctgggtccaaagcggag
ttggggcagcagacaggcacggccaccttgagggtcagcatcctcaaccagaatgaacac
agtccccgcttgtctgaggatcccaccttcctggctgtggctgagaaccagcccccagga
accagcgtgggccgagtctttgctactgaccgagactcgggacccaatggacgtctgacc
tacagcctgcaacagctatctgaagatagcaaggccttccgcatccacccccagactgga
gaagtgaccacactccaaaccctggaccgtgagcagcagagcagctatcagctcctggtg
caggtgcaggatggagggagcccatcccgaagcaccacaggcactgtgcatgttgcagtg
cttgacctcaacgacaacagccccaccttcctgcaggcttcaggagctgctggtggcggc
ctccctatacaggtaccagaccgcgtgcctccaggaacactggtgacgactctacaggcg
aaggatccagatgagggggagaatgggaccatcctgtacacgctaactggtcctggctca
gagcttttctctctgcaccctcactcaggggagctgctgactgcagctcccctgatccga
gcagagcggcctcactatgtgctgacattgagtgctcacgaccaaggcagccctcctcga
agtgccagcctccagctgctagtgcaggtgcttccctcagctcgcttgacagagccgccc
ccagatagcacagagcgggacccagcggcacctttgccggtcgtgctgacggtgacagca
gctgaggggctgcggcccggctctctgttgggctcggtggcaccgccagagcccgtgggt
gtgggggcactcacctacacattggtgggcggtgccgaccccgagggcaccttcgcgcta
gatgcggcctcagggcgcttgtacctggcgcggcccctggactttgaagctgggccccca
tggcgcgcgctcaccgtacgcgcggaggggccgggaggcgcgggcgcgcggctgctgcga
gtgcaggtgcgcgtgcaggacgagaatgagcacgcgcccaccttcgcgcgcgacccgctg
gctctcgcgttgccggagaacccggaacccggcgcagcgctgtacactttccgcgcgtca
gacgccgacggccccggccccaacagcgacgtgcgctaccgcctgctgcgccaggagccg
cccgtgcccgcgcttcgcctggacgcgcgcaccggggcgctcagcgctccgcgcggcctg
gaccgagagaccacacccgcgctgctgctgctggtggaagccaccgaccggcccgccaac
gccagtcgccgtcgtgcagcacgcgtttctgcgcgcgtctttgtcacggatgaaaacgac
aacgcgcccgtgttcgcctcgccttcacgggtgcgcctcccagaggatcagccgcctggg
cccgcggcgctgcacgtggtagccagggacccggacctgggcgaggctgcacgcgtgtcc
tatcgcctggcatctggcggggacggccacttccggctgcactcaagcactggagcgctg
tccgtggtgcggcccttggaccgcgaacgacgagctgagcacgtgctgacggtggtggcc
tcagaccacggctccccgccgcgctcggccacgcaggttctgaccgtcagtgtcgctgac
gtcaatgacgaagcgcctactttccagcagcaggagtacagcgtcctcttgcgtgagaac
agcccgcctggcacatccctcctcacactgcgagcaaccgacccagacctgggagccaac
gggcaagtgacttatggaggcgtctctagcgaaagcttttctctggatcctgacactggt
gttctcaagactcttcgggccctggatcgagaggagcaggaggagatcaacctgacagtg
tatgcccaggataggggctcacctccccagttaactcatgtcactgttcgcgtggctgtg
gaggatgagaatgaccacgcaccaacctttgggagtgcccatctctctctggaggtgcct
gagggccaggacccccagacccttaccatgcttcgggcctctgatccagatgtgggagcc
aatgggcagctgcagtaccgcatcctagatggggacccatcaggagcctttgtcctagac
cttgcttctggagagtttggcaccatgaggccactagaccgagaggtggagccagcattc
cagctgaagatagaggcccgggatggaggccagccagctctcagtgctactctgcttgtg
acagtgatagtgctagatgccaatgaccatgctccagcctttcctgtgcctgcctactct
gtggaggtgccggaggatgtgcctgcagggaccctgctgctgcagctacaggctcatgac
cctgatgctggagccaatggccgtgtaacctactacctgggtgctggtacagcaggagcc
ttcctgctggagcccagctctggagagctacgcacagctgcagccttggacagagaacag
tgtcccagctacaccttttctgtcagtgcagtggatggtgcagccgctgggcccctaagc
accacagtgtctgtcaccgtcacggtgcgcgatgtcaatgaccatgcacccaccttcccc
accagtcctctgcgcctgcgcctgccccgcccaggccccagcttcagtaccccaaccctg
gctctggccacactgagagctgaagatcgtgatgctggtgccaatgcttccattctgtac
cggctggcaggcacaccacctcctggcactactgtggactcttacactggtgaaatccgt
gtggcccgctctcctgtagctctaggcccccgggatcgtgtcctcttcgttgtggccact
gaccttggccgtccagctcgctctgccactggtgtgatcattgttggactgcagggggaa
gctgagcgtggaccccgctttccccgggctagcagtgaggctatgattcgtgagaatgcg
cccccagggactcttattgtctcccccagagctgtccatgcagggggctcaaatggaccc
atcacatacagcattctcagtgggaatgagaaagggacattctccatccagcctagtaca
ggagccatcacagttcgctcagcagaggggctggacttcgaggtgagtccacggctgcga
ctggtgctgcaggcagagagtggaggagcctttgccttctcggtgctgaccctgactttg
caagatgccaacgacaatgctccccgtttcctgcggccccattatgtggccttcctgcct
gagtcccggcccttcgaggggcccctgctgcaggtggaggcagatgacctggatcaaggc
tctggaggacagatttcctacagtctggccgcatcccagccggcacgtggattgttccac
gtagacccagccacaggcattatcactaccacagccatcctggaccgtgagatctgggct
gaaacacggttggtactgatggccacagacagagggagcccagccttggtgggctcagct
accttgacagtgatggtcattgacaccaatgacaatcgccccactatcccccagccctgg
gagctccgagtgtcagaagatgcattattgggctcagagattgcacaggtaacaggaaat
gatgtggactcaggaccagtgctgtggtatgtgctgagcccatccgggccccaggatccc
ttcagtgttgggcgctatggaggccgtgtctccctcacggggcctctggactttgagcag
tgtgaccactaccagctgcagctgctggcgcatgatgggcctcatcagggccatgccaac
ctcacagtgcttgtggaggatgtcaatgacaatgcgcctgccttctcacagagcctctac
caggtaatgctgcttgagcacacccccccaggcagtgccattctctctgtctctgccact
gatcgggactcaggtgccaacggtcacatctcctaccacctggcttcccctgctgatggc
ttcactgttgaccccaacaatgggaccctattcacaatagtggaaacagtggccttgggc
catgaggggtcaggagcagtggatgtggttctggaagcacgagaccacggggctccaggc
cgggcagcacgagccacagtacatgtgcagctgcaggaccagaatgaccacgccccgagc
ttcacattgccacactaccgtgtggctgtaactgaggacctgccccctggctccactctg
ctcaccctggaagctacagatgctgatggaagccgtacccatgccgctgtggactacagc
atcgtcagtggcaaccggggccaagtcttccagctggaacccaggctggcagaggctggt
gagggttctggaccaggcccccgggcactgggctgcctggtgttgcttgaatctctagac
tttgaaagtctgacacagtacaatctaacagtggctgcagctgaccgtgggcagccaccc
cgaagctcagttgtgccagtcactgtcactgtactagatgtcaatgacaacccacctgtc
tttacccaagcatcataccgtgtggcagtacctgaggacacacctgttggagctgagctg
ctacatgtagaggcctctgacgctgaccctggccctcatggcctcgtgcatttcgctgtt
agctcgggcgacccatcagggctctttgagctggatgagaattcgggcaccttacgactg
gcccatgccctggactgtgagacccaggctcgacatcagcttgtagtccaggctgctgac
cctgctggtgcacactttgctttggcaccagtgacaattgaggtccaagacgtaaatgat
catggcccagccttcccactgaacttactcagcaccagcctggccgagaatcagcctcca
ggcactctcgtgaccactctgcatgcaatcgatggggatgctggggcttttgggagactc
cgctatagcctgctggaggctgggccggggcccgagggccgtgaggcatttgcactgaac
agctcaacaggggaattgcgtgcacgaatgccctttgactatgagcacacagaaagcttc
cggctgctggtgggtgctgccgatgctgggaatctctcagcctctgtcactgtatcagtg
ctggtgactggagaggatgagtatgaccctgtatttctggcaccagctttccacttccaa
gtgccggaaggcgcccggcgcggccatagcttgggtcatgtgcaggccacagatgaggat
gggggtgccgatggcctggttctctattcccttgccacctcttccccctattttggtatt
aaccagactacaggtgccctgtacttgcaggtggacagtcgggcaccaggcagtggaaca
gccacctctgagggtggaggccggaccaggcgggaagcaccgcgggagctgaggctggag
gtggtagcacgagggcctctgcctggttcccggagtgccacagtgcctgtgacagtggat
atcacccacactgcactgggcctggcacctgacctcaacctactattagtaggggccgtg
gcagcctccttgggagttgtggtggtacttgcactggcagccctggtcctaggacttgtt
cgggcccgtagccgcaaggctgaggcagctcctggcccaatgtcacaagcagcaccctta
gccagtggctcactgcagaagctgggccgggagccacccagtcccccaccctctgagcac
ctctatcaccagactcttccaagctatggtgggccaggagctggaggaccctacccccgt
ggtggctccttggatccttcacattcaagtggccgaggctcagcagaagctgcagaggat
gatgagatccgcatgatcaatgagttcccccgtgtggccagtgtggcctcctctctggct
gcccgtggccctgactcaggcatccagcaggatgcagatggactgagtgacacatcctgt
gagccacctgcccctgaaacctggtataagggccgaaaggcagggctgctgcttccaggt
acaggaaccactctctaccgagaggaggggccccccaccactgccacagctttcctgggg
ggctgtggcttgagcccggcacccactggggactatggcttcccagcagatggcaagcca
tgtgtggcaggtgcactgacagccattgtggccggcgaggaggagctccgtggcagctat
aactgggactacctgctgagttggtgccctcagttccaaccactggccagtgtcttcaca
gagatcgctcggctcaaggatgaagctcggccatgtcccccagctccccgtatcgaccca
ccacccctcatcactgccgtggcccacccaggagccaagtctgtgccccctaagccagca
aacacagctgcagcccgggccatcttcccaccagcttctcaccgctcccccatcagccat
gaaggctccttgtcctcagctgccatgtcccccagcttctcaccctctctgtctcctttg
gctgctcgctcacccgttgtctcaccatttggggtggcccagggtccctcagcctcagca
ctcagcgcagagtctggcctggagccacctgatgacacggagctgcacatctag

DBGET integrated database retrieval system