KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028459
Entry
101028459         CDS       T04350                                 

Gene name
AFF2
Definition
(RefSeq) AF4/FMR2 family member 2 isoform X3
  KO
K15194  AF4/FMR2 family member 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101028459 (AFF2)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101028459 (AFF2)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 101028459
NCBI-ProteinID: XP_003939133
Position
Unknown
AA seq 1276 aa
MDLFDFFRDWDLEQQCHYEQDRSALKKREWERRNQEVQQEDDLFSSGFDLFGEPYKTNKG
DALANRVQNTLGNYDEMKDLLTNHSNQNHLVGIPKNSVSQTPINKNEPSFFPEQKNRIIP
PHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTL
TQDQSQAKLEDLFVYPAEQPQIGEVEESNQSAKEDSNAKSSGEDAFKEIFQSNSPEESEF
AVQAPGSPLVASSLLAPSSGLSVQNFPPGLYGKTSMGQQKPTAYVRPMDGQDQAPDLSPT
LKPSIEFENSFGNLSFGTLLDGKPSAACSKTKLPKFTILQTSEVSLPSDPSCVEEILRES
QHLTPGFTLQKWNDPTTRASTKSVSFKSMLEDDLKLSSDEDDLEPVKTLTTQCTATELYQ
AVEKAKPRNNPVNPPLATPQPPPAMQASGGSGSSSESESSSESDSDTESSTTDSESNEAP
RVATPEPEPPSTNKWQLDKWLNKVTSQNKSFICGQNETPMETVSLPPPIIQPMEVQMKVK
TNVSQVPAEPKERPLLSLIREKARPRPTQKTPETKALKHKLSASSETVSQRTVGKKQPKK
VEKNTSIDEFTWPKPNITSSTPKDKESVELPDPPRGRNKATAHKPAPRKEPRPNIPLATE
KKKYRGPGKIVPKSREFIETDSSTSDSNTDQEETLQIKVLPPCIISGGNPAKSKEVCGAG
LTLSTLMSNSDGNNNLSISNEEPTFSPIPVVQTEILSPLRDHENMKNLWVKIDLDLLSRV
PGHNSLHAAPSKPDHKETATKPKRQTAVAPVEKPAPKGKRKHKPTEVAEKIPEKKQRLEE
ATTICLLPPCISPAPPHKPPNTRENNSSRRANRRKEEKLFPPPLSPLPEDPPRRRNVSGS
NGSFGQDKNISMTGQITSTKPKRTEGKFCATFKGISEGETPKKAASATVTVTNTAIATAT
VTTTAIVTTTVTATATATATTTTTTTTISTVTSTITTGLMDSSHLEMTSWAALPLLSSSS
TNVRRPKLTFDDSVHNADYYMQEAKKLKHKADALFEKFGKAVNYADAALSFTECGNAMER
DPLEAKSPYTMYSETVELLRYAMRLKNFSSPLASDGDKKLAVLCYRCLSLLYLRMFKLKK
DHAMKYSRSLMEYFKQNASKVAQIPSPWVGNGKNTPSPVSLNNVSPMNAMGNCNNGPVTI
PQRIHHMAASHVNITSNVLRGYEHWDMADKLTRENKEFFGDLDTLMGPLTQHSSMTNLVR
YVRQGLCWLRIDAHLL
NT seq 3831 nt   +upstreamnt  +downstreamnt
atggatctattcgactttttcagagactgggacttggagcagcagtgccactatgaacaa
gaccgtagtgcacttaagaaaagggaatgggagcggaggaatcaagaagtccagcaagaa
gacgatctcttttcttcaggctttgatctttttggagagccatacaagacaaacaaaggt
gatgcacttgccaaccgagtccagaacacgcttggaaactatgatgaaatgaaggatttg
ctaactaaccattctaatcagaatcatctagtgggaattccaaagaattctgtgtcccaa
actcccatcaacaaaaatgaaccaagcttttttccagaacagaagaacaggataattcca
cctcaccaggataacacccatccttcagcaccaatgcctccaccttctgttgtgatactg
aattcaactctaatacacagcaacagaaaatcgaaacctgaatggtcacgtgatagtcat
aatcctagcactgtactggcaagccaggccagtggtcagccaaacaagatgcagactttg
acacaggaccagtctcaagccaaactggaagacttatttgtgtacccagctgaacagccc
cagattggagaagttgaagagtcaaaccaatctgcaaaggaagacagcaatgctaagtcc
agtggagaagacgctttcaaggaaatctttcaatccaattcaccagaagaatctgaattt
gccgtgcaagctcctgggtctcccctagtggcgtcctctttgttagctcccagcagtggc
ctttcagttcaaaacttcccaccagggctttacggcaaaacaagcatggggcagcaaaag
ccaactgcgtacgtcagacccatggatggccaggaccaggcaccagacctctctccaaca
ctgaaaccttcaattgaatttgagaacagctttgggaatctgtcatttggaacactcttg
gatggaaaacccagtgcagcctgttcaaagactaaactgccaaagttcaccatcctccaa
acaagtgaagtaagccttcccagtgatccaagctgtgttgaagaaatcttgcgggaatcg
cagcatctgaccccaggattcaccttacaaaagtggaatgacccaaccaccagagcttct
acaaagtcagtatctttcaaatcgatgcttgaggatgacctaaagctgagcagtgatgaa
gatgaccttgagcctgtgaagaccttgactactcagtgcactgccactgagctctaccag
gctgttgaaaaggcaaaacctaggaataatcctgtgaacccacccttggccactccccag
cccccacctgcaatgcaagccagcgggggttctggcagctccagtgaatcagagagcagc
tctgagtcagattcagacactgaaagcagcaccactgacagcgaatctaatgaggcacct
cgtgtggccactccagagcctgagccaccctcaaccaacaagtggcaactggataaatgg
cttaacaaagtgacatcccagaacaagtcttttatttgtggccaaaatgaaacaccgatg
gagacggtttctctgcctcctccaatcatccaaccaatggaagtccagatgaaagtgaag
acaaatgtcagtcaggtcccggctgaacccaaagaaaggcctctcctcagtctcattagg
gagaaagcccgtccacggcccactcagaaaactccagaaacaaaggctttgaagcataag
ttgtcagcaagtagtgagacagtgtctcaaaggacagttgggaaaaaacagcccaaaaag
gttgagaagaacaccagcattgacgagtttacctggcccaaaccaaatattaccagcagc
actcccaaagataaagaaagtgtggagcttcctgatccaccaagaggccgcaacaaagcc
actgcccacaaaccagcccctaggaaagaaccaagacctaacatccccttggctaccgag
aagaagaagtacagagggcctggcaagattgtgccaaagtctcgggaattcattgaaaca
gattcatctacatctgactccaacacagatcaggaagagaccctgcaaatcaaagtcctg
cctccgtgtattatttctggaggtaatcctgccaaatccaaggaagtctgtggtgccggc
ctgaccctcagcaccttaatgagcaacagtgacggcaacaacaacttatccatcagtaat
gaagagccaacattttcacccattcctgtcgtgcaaactgagattctgtcccctctgcga
gatcatgagaacatgaaaaacctctgggtgaagattgaccttgacttactctctagagta
cctggccacaactccctccatgcagcaccttccaagccagaccacaaggagactgccaca
aaacccaagcgtcagacagctgtcgcccctgtggagaaaccagcccctaagggcaagcgt
aagcacaagccaacagaagttgcagagaagattcctgagaagaagcagcgcctggaggag
gccacaactatctgcttgctccctccttgcatctcaccagccccacctcacaaacctccc
aacactagagaaaataattcatccaggagagcaaacagaagaaaggaagaaaaactattt
cctcctccactttccccactgccagaggatcctccacgccgcagaaatgtcagtggcagt
aatggttcctttggacaagacaaaaacatctccatgactggacaaatcacatctaccaaa
cctaagagaaccgaaggcaaattctgtgctactttcaaagggatatcggagggagagact
ccaaaaaaggcagcctctgccaccgtcactgtcaccaacactgctattgctactgccact
gtcactactactgccattgtcaccaccactgtcacagctactgcaaccgccacggccacc
accacaactactaccactaccatttccaccgtcacctctaccatcactactggcctcatg
gatagcagtcacctggagatgacgtcctgggcggctctgccccttctttccagcagcagc
actaatgttcggagacccaagctcacgtttgatgactcggttcacaatgctgattattac
atgcaagaggctaagaagctgaagcacaaagctgatgcactgttcgagaaatttggcaaa
gctgtgaattacgctgatgccgccctatccttcactgaatgtggcaatgccatggaacgc
gaccctctggaagcaaagtcgccatacaccatgtactctgagactgtggagctcctcagg
tatgcaatgaggctgaagaacttttcaagtcccttggcttcagatggggacaaaaagcta
gcagtactatgctaccgatgtttatcactcctctatttgaggatgtttaagctgaagaag
gaccatgctatgaagtactccagatcactgatggaatattttaagcaaaatgcttcaaaa
gtcgcacagataccatctccatgggtaggcaatggaaagaacactccatccccagtgtct
ctcaacaacgtctcccccatgaacgcaatggggaactgtaacaacggcccagtcaccatt
ccccagcgcattcaccacatggctgccagccacgtcaacatcactagcaatgtgttacga
ggctatgaacactgggatatggccgacaaactgacaagagaaaacaaagaattctttggt
gatctggacacactgatggggcctctgacccagcacagcagcatgaccaatcttgtccgc
tacgttcgccaaggactgtgttggctgcgcatcgatgcccacttgttgtag

DBGET integrated database retrieval system