KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028778
Entry
101028778         CDS       T04350                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X2
  KO
K04829  acid-sensing ion channel 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101028778 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sbq04040]
    101028778 (ASIC1)
Ion channels [BR:sbq04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   101028778 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 101028778
NCBI-ProteinID: XP_003939198
Position
Unknown
AA seq 528 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLD
FFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEY
CVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI
EQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSA
DKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggaactgaaggccgaggaggaggaggtgggtggcgtccagccggtgagcatccaggcc
ttcgccagcagctccacgctgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcactgtgggccctgtgcttcctgggctctctggctgtgctgctgtgtgtg
tgcacggagcgtgtgcagtactacttccactaccaccacgtcaccaagctcgacgaggtg
gctgcctctcagctcaccttccctgctgtcacactgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtatcatgccggagagctgctggctctgctcaacaac
aggtatgagataccagacacacagatggcagatgaaaagcagctggagatattgcaggac
aaagccaacttccgaagcttcaaacccaaacccttcaacatgcgtgagttctacgaccga
gctgggcacgacattcgagacatgctgctctcctgccacttccggggggaggtctgtagc
gctgaagacttcaaggtggtcttcacacggtatggaaagtgctacacgttcaactcaggc
cgagatgggcggccacggctgaagaccatgaagggtgggacaggcaatgggctggaaatc
atgctggacatccagcaggacgagtacctgcctgtgtggggggagactgacgagacatcc
ttcgaagcaggcatcaaagtgcagatccatagtcaggatgaacctcctttcatcgaccag
ctgggctttggcgtggccccaggcttccagacctttgtggcctgccaggagcagcggctc
atctacctgcccccgccctggggcacctgcaaagctgttaccatggactcggatttggat
ttcttcgactcctacagcatcaccgcctgccgcatcgactgtgagacccgctacctggtg
gagaactgcaactgccgcatggtgcacatgccaggggatgccccatactgtactccagag
cagtacaaggagtgtgcagatcctgctctggacttcctggtggagaaggaccaggagtac
tgcgtgtgtgaaatgccttgcaacctgacccgctatggcaaggagctgtccatggtcaag
atccccagcaaagcctcagccaagtacctggccaagaagttcaacaagtctgagcaatac
ataggggagaacatcctggtgctggacattttctttgaagtcctcaactatgagaccatt
gagcagaagaaggcctatgagattgcagggctcctgggtgacatcgggggccagatgggg
ctgttcatcggggccagcatcctcacggtgctggagctctttgactacgcctacgaggtc
attaagcacaagctgtgccgacgaggaaagtgccagaaggaggccaaaaggagcagcgca
gacaagggcgtggccctcagcctggacgacgtcaaaagacacaacccatgcgagagcctc
cggggccaccctgccgggatgacatacgctgccaacatcctacctcaccatccggcccga
ggcacgttcgaggactttacctgctga

DBGET integrated database retrieval system