KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028900
Entry
101028900         CDS       T04350                                 

Gene name
ACY3
Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101028900 (ACY3)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     101028900 (ACY3)
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 101028900
NCBI-ProteinID: XP_003941237
UniProt: A0A2K6TGV4
Position
Unknown
AA seq 319 aa
MCSLPLPREPLRRVAVAGGTHGNELSGVYLVRHWLLAPAELQRPSFSAVPVLANPAATAA
CRRYVDRDLNRTFTSTFLNSTPTPDDPYEVTRARELNQLLGPKASGRAFDFVLDLHNTTA
NMGTCLIAESSHDVFALHLCRHLQLQYPELSCQVFLYQRSGEESHNLDSVAKNGLGLELG
PQPQGVLRADIFSRMRALVATVLDFIELFNQGTAFPAFEMEAYSPVGVTDFPRTAAGDLA
GSVHPQLQDQDFQPLQPGDPIFQTFSGEDLLYEGESTVYPVFINEAAYYEKGVAFVQTEK
LTFSVPAMPAPTPAPSPAS
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtgctcactgcccctgccccgggagcccctgcgccgcgtggcggtggccgggggcacg
cacggcaacgagctgtcgggcgtctacctggtgcggcactggctgctggccccggcagag
ctgcagagacccagcttctccgcagtgccggtgctggccaaccccgcagccaccgccgcc
tgccgccgctatgtggaccgcgacctcaaccgcaccttcaccagcaccttcctcaattcc
acgcctaccccggacgacccatacgaggtgacgagagcccgagagctgaaccagctgctg
gggcccaaggcctcgggccgggcctttgactttgtccttgacctgcacaacaccacggcc
aacatgggcacctgcttaatcgcagagtcctcccacgacgtctttgccttgcacctgtgc
cgccatctgcagctgcagtaccccgagctgtcctgccaggtcttcctgtaccagcggtcc
ggggaggagagccacaatctggactccgtggccaaaaacggattgggtctggagctgggc
ccccagccacagggtgtgctgcgggctgacattttctccaggatgagggccctggtggcc
acagttctggacttcatcgaactcttcaaccagggcacagcctttcccgcctttgagatg
gaagcctatagccccgtgggcgtcacggacttcccccgcactgcggctggggacctggca
ggcagcgtgcatcctcagctgcaggaccaagacttccagccgctgcagcccggtgatccc
atcttccaaacgttcagcggagaggacctgctctatgaaggggagtccacggtgtacccc
gtgttcattaacgaggctgcctactatgagaagggcgtcgcctttgtccagactgaaaag
ttgacattctccgtgcctgccatgcccgcgccgacccctgcccctagcccagcttcctaa

DBGET integrated database retrieval system