KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028986Help
Entry
101028986         CDS       T04350                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X3
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04520  Adherens junction
sbq04910  Insulin signaling pathway
sbq04913  Ovarian steroidogenesis
sbq04923  Regulation of lipolysis in adipocytes
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease (NAFLD)
sbq04960  Aldosterone-regulated sodium reabsorption
Module
sbq_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101028986 (INSR)
   04015 Rap1 signaling pathway
    101028986 (INSR)
   04010 MAPK signaling pathway
    101028986 (INSR)
   04066 HIF-1 signaling pathway
    101028986 (INSR)
   04068 FoxO signaling pathway
    101028986 (INSR)
   04072 Phospholipase D signaling pathway
    101028986 (INSR)
   04022 cGMP - PKG signaling pathway
    101028986 (INSR)
   04151 PI3K-Akt signaling pathway
    101028986 (INSR)
   04152 AMPK signaling pathway
    101028986 (INSR)
   04150 mTOR signaling pathway
    101028986 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101028986 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101028986 (INSR)
   04923 Regulation of lipolysis in adipocyte
    101028986 (INSR)
   04913 Ovarian Steroidogenesis
    101028986 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101028986 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    101028986 (INSR)
   04213 Longevity regulating pathway - multiple species
    101028986 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101028986 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101028986 (INSR)
   04931 Insulin resistance
    101028986 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101028986 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:sbq04090]
    101028986 (INSR)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101028986 (INSR)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   101028986 (INSR)
CD molecules [BR:sbq04090]
 Proteins
  101028986 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 101028986
NCBI-ProteinID: XP_003938921
UniProt: A0A2K6T1F3
Position
Unknown
AA seq 1370 aa AA seqDB search
MGAGGRRGAAAAPLLVAVAALFLGAAGQMYPGEVCPGMDIRNNLSRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYSLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTSKGKTNCPATVINGQFVERCWTHSHCQKVCPTVCKSHGCTAEGLCCHSECL
GNCSEPGDPTKCVACRNYYLDGRCVDSCPPPYYQFQDWRCVNFSFCQDLHYRCKNSRRQS
CYQYVIHNNRCLPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEREKIIDSVTSAQDLRGC
TVINGSLIINIRGGNNLAVELEANLGLIEEISGYLKIRRSYALVSLAFFRKLRLIRGETL
EAGNYSFYALDNQNLRQLWDWSKHNLTIVQGKLFFHYNPKLCLSEIHKMEEISGTKGRQE
KNDIALKTNGDQASCENELIKFSSIRTSSDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSSDPTSQSHPGWLMRNLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTAATNPSVPLDPISVSNSSSQIILKWKPPTDPNGNITHYLVFWQ
RQVEDSELFELDYCLKGLKLPSRTWSPPVESEGFQKHNQSEEEDLAGECCSCPKTDSQIQ
KELEESSFRKTFEDYLHNVVFIPRPTRKRRSLDDIGNMTEAEPTVAALPNTSLTMEPMSP
EEPKPFEKVVNRESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADD
IVSPVTHEILENNIVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFTLERGCR
LRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVSDYLDVPSNIAKIIIGPLIFVFLFSVVI
GSIYIFLRKRQQDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLLRELGQG
SFGMVYEGNAKDVIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGV
VSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNA
KKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGI
FTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMEGGYLDQPDNCPERVTDLMRMC
WQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRS
SHCQREETGGRDGGSSLGLKRSYDEHIPYTHMNGGKKNGRILALPRSNPS
NT seq 4113 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgggggccgccggggggcggcggccgcgccgctgctggtggctgtggccgcg
ctgttcttgggcgccgctggccaaatgtaccccggagaggtgtgccctggcatggatatc
cggaacaatctcagcaggctgcatgagctggagaattgctctgtcatcgaaggacactta
cagatactcttgatgttcaaaacgaggcctgaagatttccgagacctcagtttccccaaa
ctcatcatgatcactgattacttgctgctcttccgggtctatgggctcgagagcctgaaa
gacctgttccccaacctcaccgtcatccggggatcgagactgttcttcaactatgcgctg
gtcatcttcgagatggtgcacctcaaggaactcggcctctacagcctgatgaacatcacc
aggggttctgtccgcattgagaagaacaatgagctctgctacttggccactattgactgg
tcccgtatcctggattccgtggaggacaattacattgtgttgaacaaagatgacaacgag
gagtgtggagacatctgtccaggtacctcgaagggcaagaccaactgccctgccactgtc
atcaacggacagtttgtcgaacggtgttggactcacagtcattgtcagaaagtttgcccg
accgtctgtaagtcacacggctgcaccgcggaaggcctctgttgccacagtgaatgcttg
ggcaactgttccgagcccggtgaccccaccaagtgcgtggcctgccgcaactactacctg
gacggcaggtgtgtggactcctgcccgcccccatactaccagttccaggactggcgctgc
gtgaacttcagcttctgccaggacctgcactacagatgcaagaactcgcggaggcagagc
tgctaccagtacgtcattcacaacaacaggtgtctccccgagtgtccctctgggtacacg
atgaattccagcaacttgatgtgcaccccgtgcctgggtccctgtcccaaggtgtgccac
cttttagaacgcgagaaaatcatcgactcagtgacgtctgcccaggatctccgaggatgc
accgtcatcaatgggagtctgatcatcaacattcgaggaggcaacaatctggcagttgag
ctagaagccaacctcggcctcattgaagaaatttcagggtatctaaaaatccgccgatcc
tacgctctggtatcacttgccttctttcggaagttgcgtctgattcgaggagagaccttg
gaagccgggaactactccttctatgccttggacaatcagaacctaaggcagctctgggac
tggagcaaacacaacctcaccatcgttcaggggaaactcttcttccactataaccccaaa
ctctgcttgtcagaaatccacaagatggaagaaatttcaggaaccaaggggcgccaggag
aagaatgacattgccttaaagaccaatggggaccaagcatcctgtgaaaatgaattaatt
aaattttcttccattcggacgagttctgacaagatcttgctgaaatgggagccgtactgg
ccccctgacttccgagatctcttggggttcatgctgttctacaaagaagccccttatcag
aatgtgacggagttcgacgggcaggatgcttgtggttccaacagttggacggtggtagac
attgacccaccccagaggtccagtgaccccacgtcacagagccacccaggatggctgatg
cggaatctcaagccctggacccagtatgctatctttgtgaagaccctggtcaccttttcc
gatgaacgccggacctatggggccaagagtgacatcatttatgtccagacagctgccacc
aacccgtccgtgccactggatccaatctcagtgtctaactcatcatcccagattattctg
aagtggaaacccccgacggaccccaatggcaacatcacccactacctggttttctggcag
aggcaggtggaagacagtgagctgttcgagttggattattgcctcaaaggattgaagctg
ccctcaaggacgtggtctccaccagttgagtctgaaggttttcagaagcacaaccagagt
gaagaggaggatttggccggcgagtgttgctcctgtccaaagacagactctcagatccag
aaggagctggaggagtcctcgtttaggaagacgtttgaggattacctgcacaatgtcgtt
ttcatccccaggccgactcggaaacgcaggtcccttgatgacattgggaacatgacagag
gccgagcccacggtggcagctctccctaacacttccttgaccatggagcccatgagtccg
gaggagcccaagcccttcgagaaggtggtgaacagagagtcgctggtcatctctggcttg
cgacacttcacgggctatcgcatcgagctgcaggcttgcaaccaagacacccccgaggaa
cggtgcagcgtggcagcctatgtcagcgccaggaccatgcctgaagccaaggctgatgac
atcgtcagccctgtgacccacgaaatccttgagaacaacatcgtccacttgatgtggcag
gagccaaaggaacccaatggtctgatcgtgctgtatgaagtgagttatcggcgatatggc
gatgaggagctgcatctctgtgtctcccgcaagcacttcactctggaacggggctgcagg
ctgcgtgggctgtcgccggggaactacagcgtgcgagttcgggccacttccctagcgggc
aacggctcctggacggaacccacctatttctacgtatcggactacttagatgtcccatca
aatattgcaaaaattatcatcggccccctcatctttgtctttctcttcagcgttgtgatt
ggaagtatttatatattcctgagaaagaggcagcaagatggaccactgggaccactttat
gcttcttcaaaccctgagtatctcagtgccagtgatgtgtttccatgctctgtatacgtg
ccggacgagtgggaggtgcctcgagagaagatcaccctccttcgtgagctgggacagggc
tccttcggcatggtgtatgagggcaatgccaaggacgtcatcaagggtgaggcagagacc
cgtgtggcagtgaagacggtcaacgaatcagccagtctccgagagcgaattgagttcctc
aatgaggcctcagtcatgaagggcttcacctgccatcacgtggtgcgcctcctgggagtg
gtgtccaagggccagcccacgctggtggtgatggagctgatggctcacggagacctgaag
agctacctccgttctctgcggccagaggctgagaacaatcccggccgccctccccccacc
ctgcaagagatgattcagatggcagcagagattgctgacgggatggcttacctgaacgcc
aagaagtttgtgcatcgggacctggcagccagaaactgcatggtcgcccatgatttcact
gtcaaaattggagactttggaatgaccagagacatctatgaaacagattactaccggaaa
gggggcaagggtctgctccctgtgcggtggatggcaccagagtccctgaaggacgggatc
tttaccacttcttctgacatgtggtcctttggcgtggtcctctgggaaatcaccagcttg
gcagaacagccttaccaaggcctgtctaatgaacaagtgctgaagttcgtcatggaagga
gggtatctggatcaacccgacaactgtccagagagagtgaccgatctcatgcgtatgtgc
tggcaattcaaccccaagatgaggccaaccttcctggagattgtcaacttgctcaaggat
gacctgcatcccagctttccggaggtatccttctttcacagcgaggagaacaaggctccc
gagagcgaggagctggagatggagtttgaggatatggagaacgtccccctggatcgttcc
tcccactgtcagagggaggagaccgggggccgggatggagggtcctcactgggtctcaag
cggagctatgacgaacacatcccctacacccacatgaacggaggcaagaagaacgggcgg
attctggccttgcctcggtccaatccttcctaa

DBGET integrated database retrieval system