KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029385Help
Entry
101029385         CDS       T04350                                 

Gene name
B4GALT4
Definition
(RefSeq) beta-1,4-galactosyltransferase 4
  KO
K07969  beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.275 2.4.1.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00533  Glycosaminoglycan biosynthesis - keratan sulfate
sbq00601  Glycosphingolipid biosynthesis - lacto and neolacto series
sbq01100  Metabolic pathways
Module
sbq_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    101029385 (B4GALT4)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    101029385 (B4GALT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sbq01003]
    101029385 (B4GALT4)
Enzymes [BR:sbq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     101029385 (B4GALT4)
    2.4.1.275  neolactotriaosylceramide beta-1,4-galactosyltransferase
     101029385 (B4GALT4)
    2.4.1.-  
     101029385 (B4GALT4)
Glycosyltransferases [BR:sbq01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   101029385 (B4GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 101029385
NCBI-ProteinID: XP_010344258
UniProt: A0A2K6SN04
Position
Unknown
AA seq 344 aa AA seqDB search
MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPQAKKFMASFHKAIILGKG
KTLTNEASTRKTELDNCSSVSPYLKGQSKLIFKPDLTLEEVQAENPKVSRGRYCPEECKA
LQRVAILIPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAGGKKFNRAKLLNVGYLE
ALKEENWDCFIFHDVDLIPENDFNLYKCEDNPRHLVVGRNSTGYRLRYSGYFGGVTALSR
EQFFKVNGFSNNYWGWGGEDDDLRHRVELHRMKISRPLPEVGKYTMIFHTRDRGNEVNGE
RMKLLHQVSRVWRTDGLSSCSYKLLSVEYNPLYVNITVDFWSGA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcaacctgactttccacctttcctacaagttccgattactgctgcttttgact
ttgtgcctgacggtggttggatgggccaccagtaactactttgtgggtgccattcaagag
attcctcaagcaaagaagttcatggctagtttccataaggccatcattttggggaaggga
aaaactctgactaatgaagcatccacaaggaagacagaacttgacaactgctcttctgtg
tctccttacctcaaaggccagagcaagctcattttcaaaccagatcttactttggaagag
gtacaggcagaaaatcccaaagtgtccagaggccggtattgccctgaggaatgtaaagct
ttgcagagggtcgccatcctcattccccaccggaacagagagaaacacctgatgtacctg
ctggaacatctgcatcccttcctgcagaggcagcagctagattatggcatctacgtcatc
caccaggctggaggtaaaaagtttaatcgagccaaactcttgaatgtgggctatctagaa
gctctcaaggaagaaaactgggactgctttatattccatgacgtggacttgatacccgag
aatgacttcaatctttacaagtgtgaggacaatcccaggcatctggtagttggcaggaac
agcactgggtacaggttacgttacagtggatattttgggggtgttactgccctaagcaga
gagcagtttttcaaggtgaatggattctctaacaactactggggatggggaggcgaagac
gatgacctcagacacagggttgaactccatagaatgaaaatatcccggcccctacctgaa
gtgggtaaatatacaatgatcttccacactagggacagaggcaatgaggtgaatggagaa
cggatgaagctcttacaccaggtgtcacgagtctggagaacagatgggttgagtagttgt
tcttacaaattactgtctgtggaatacaatcctttatatgtcaacatcacagtggatttc
tggtctggtgcatga

DBGET integrated database retrieval system