KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029501Help
Entry
101029501         CDS       T04350                                 

Gene name
ABHD6
Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101029501 (ABHD6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sbq01002]
    101029501 (ABHD6)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101029501 (ABHD6)
Peptidases [BR:sbq01002]
 Serine Peptidases
  Family S33
   101029501 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 FSH1 BAAT_C Lipase DLH Esterase DUF2048 Thioesterase
Motif
Other DBs
NCBI-GeneID: 101029501
NCBI-ProteinID: XP_003936573
UniProt: A0A2K6S2T7
Position
Unknown
AA seq 337 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLICVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVSSLCLVCPAGLQYST
DNQFIQRLKELQDSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIVDFLASVHNTNNNKKLD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgatgtggttaacatgtttgtgattgcgggcgggacactggccatcccaatc
ctggcattcgtagcctcatttctcctgtggccttcagcactgataagaatctattattgg
tactggcggaggacattgggcatgcaagtccgctatgttcaccatgaagactatcagttc
tgttattccttccggggcaggcctggccacaaaccctccatcctcatgctccatggattc
tctgcacacaaggatatgtggctcagtgtggtcaagttccttccaaagaacctgcacttg
atctgcgtggacatgccaggacatgagggcactacccgctcctccctggatgacctgtcc
atagatgggcaagtcaagaggatacaccagtttgtagaatgcctcaagctgaacaaaaaa
cctttccacctgataggcacctctatgggtggccacgtggctggggtgtatgctgcttac
tacccatcagatgtctccagcctgtgtcttgtgtgtcctgctggcctgcagtactcaact
gataatcagttcatacaacggctcaaagaactgcaggactctgccgccgtggagaagatt
cccttgatcccgtctaccccagaagagatgagtgaaatgcttcagctctgctcctatgtc
cgcttcaaggtgccccagcagatcctgcaaggccttgttgacgtccgcatccctcataac
aacttctaccgaaagctgtttttggaaatcgtcagtgagaagtccagatactctctccat
cagaacatggacaagatcaaggtcccgacgcagatcatctggggaaaacaagaccaggtg
ctggatgtctctggggcggacatgttggccaagtcaattgccaattgccaggtggagctt
ctggaaaactgtgggcactcggtagtgatggagagacccaggaagacagccaaactcatt
gtcgactttttagcttctgtgcacaacacaaacaacaacaagaagctggactga

DBGET integrated database retrieval system