KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029717Help
Entry
101029717         CDS       T04350                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101029717 (DOCK7)
Membrane trafficking [BR:sbq04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    101029717 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 101029717
NCBI-ProteinID: XP_010346565
Position
Unknown
AA seq 2004 aa AA seqDB search
MDPHVRDCVRSYTEDWAIVIRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNN
YQDDQDDLKRRSMSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDRQNDDQRK
SNRHKELFALHPSPDEEEPIERLSVPDVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALY
DVKEKKKISENFYFDLNSEQMKGLLRPHVPPAAITTLARSAIFSITYPSQDVFLVIKLEK
VLQQGDIGECAEPYMIFKEADATKNKEKLEKLKSQADQFCQRLGKYRMPFAWTAIHLMNI
VSSAGSLERDSTEVEISTGERKGSWSERRNSSIVGRRSLERTTSGDDACNLTSFRPATLT
VTNFFKQEGDRLSDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPEL
LQVKLYPDSRVRPTREILEFPARDVYVPNTTYRNLLYIYPQSLNFANRQGSARNITVKVQ
FMYGEDPSNAMPVIFGKSSCSEFSKEAYTAVVYHNRSPDFHEEIKVKLPATLTDHHHLLF
TFYHVSCQQKQNTPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLP
GMKWVDNHKGVFNVEVVAVSSIHTQDPYLDKFFALVNALDEHMFPVRIGDMRIMENNLEN
ELKSSISALNTSQLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRL
HKNLEGNHDQHGRNSLLASYIYYVFRLPNTYPNSSSPGPGGLGGSVHYATMARSAVRPAS
LNLNRSRSLSNSNPDISGTPTSPDDEVRSIIGSKAMDRSCNRMSSHTETSSFLQTLTGRL
PTKKGKEDELEKLSLLLFHEELALQWVVCSGSVRESALQQAWFFFELMVKSMVHHLYFND
KLDAPRKSRFPERFMDDIAALVSTIASDIVSRFQKDTEMVERLNTSLAFFLNDLLSVMDR
GFVFSLIKSCYKQVSSKLYSLPNPSVLVSLRLDFLRIICSHEHYVTLNLPCSLLTPPASP
SPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLVLTELAVILDPDAEGLFG
LHKKVINMVHNLLSSHDSDPRYSDPQIKARVAMLYLPLIGIIMETVPQLYDFTETHNQRG
RPICIAPDDYESESGSMISQTVAMAIAGTSVPQLTRPGSFLLTSTSGRQHTTFSAESSRS
LLICLLWVLKNADETVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFERMNSLTFK
KSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMTHWRQNTE
KLDKSRADIEHEALIDGNLATEANLIILDTLEIVVQTVSVTESKESILGGVLKVLLHSMA
CNQSAVYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSISTIRSHASASL
YLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEEDLELRET
TFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAG
KHSERSNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVV
SPDEEGICSGKYFTESGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPVHEANRDAKKLST
IHGKLQEAFSKIVHQSTGWERMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHR
LEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNY
NLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVA
IEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFR
HHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQL
YKAVLPVTCHRDSFSRMSLRKMDL
NT seq 6015 nt NT seq  +upstreamnt  +downstreamnt
atggatccacatgttagagactgtgtaagaagttataccgaagactgggcaattgtcatc
agaaagtatcataaattgggaacaggatttaatcccaatacattagataaacagaaagaa
aggcaaaaaggtttaccgaaacaggtctttgaatctgatgaagctccagatggcaacaac
taccaggatgaccaagatgatcttaaaagacgttcaatgtcaatagatgataccccgagg
ggtagctgggcctgtagtatctttgacttgaaaaattcacttcctgatgctttgcttccc
aatttacttgatcgaactccaaatgaagaaatagaccgtcagaatgatgaccaaaggaaa
tcaaaccgtcacaaagaactttttgctttgcatccatcaccagatgaggaagaaccaata
gaacggcttagtgttcctgatgtacccaaagaacattttggtcaaagacttcttgtaaaa
tgcttatcgcttaagtttgaaattgaaattgaacccatttttgcgagtttggctttatat
gatgttaaggaaaagaaaaagatttcagaaaacttttattttgaccttaattctgagcaa
atgaaaggattgttacgtccacatgtaccacctgctgccattaccaccctggcaagatca
gcaattttttctatcacgtatccttcccaagatgtttttcttgtaataaagctagaaaaa
gtcctacagcaaggagacattggagagtgtgcagaaccatatatgattttcaaagaagca
gatgccaccaagaataaggaaaaactggagaaactgaagagtcaagcagatcagttttgc
caaagacttgggaaatatcgcatgccttttgcttggactgcaatccatttaatgaatatt
gttagcagtgctgggagtttggaaagagattctacagaagtagaaatcagtactggagaa
cgaaaagggtcttggtcagagaggaggaattctagcattgttggcagacgatcacttgaa
aggacaacgagtggagatgatgcttgtaacttgacaagttttcgaccagctactctcaca
gtgacaaatttttttaagcaggaaggagaccgcttaagtgatgaagatctctacaaattc
cttgctgatatgagaaggccgtcttctgtcttacggcgactaagacctattacagctcag
ctcaagatagacatttctcccgcacctgaaaatccccattattgcctaactccagagctg
cttcaagtgaagctttaccctgacagtagagttagacctaccagagaaattttagagttt
cctgcaagggatgtttatgttccaaacactacttacagaaatcttctctacatataccct
cagagtcttaattttgccaatcgtcaaggttctgctagaaatataacagtgaaagtccag
tttatgtatggagaggatccaagcaatgccatgccggtaatctttggtaaatctagctgt
tcagaattttcaaaggaagcctatacagccgtagtatatcataacaggtctcctgatttt
catgaagaaatcaaggttaagcttcctgctactttaactgatcatcatcacttgcttttt
actttttatcacgttagttgtcaacaaaaacaaaatactcctcttgaaacgccagttgga
tatacatggataccaatgcttcagaatggacggttgaagactggccagttttgcttacca
gtctcattggaaaaaccaccacaggcttattctgtactgtctcctgaggttcctctacct
ggcatgaaatgggtagataatcacaaaggtgtttttaatgttgaagttgttgctgtttca
tctatccatacacaagatccttatcttgacaagttttttgctctggtcaatgctctggat
gaacacatgttcccagtacgaattggggacatgcgaatcatggaaaataacttagaaaat
gaattgaagagcagtatttcagcactgaatacatctcagttggaaccagtggtccgattt
cttcatcttctgctagataaactgatacttttagttgttagacctcctgtcattgctggc
caaatagttaatctaggtcaagcatcttttgaagccatggcatcaattataaatcgactt
cacaaaaacttggaaggaaatcatgaccagcatggcagaaacagccttcttgcatcatat
atttattatgttttccgcctaccaaatacttaccctaattcatcttcaccaggtcctggg
ggtttgggaggatcagtgcattatgccacaatggctagatctgctgtgagacctgcaagc
cttaatttaaatcgttctcgaagccttagtaatagcaatccagatatatctgggactccc
acgtcaccagatgatgaagttcgatcaatcatcgggagtaaggctatggatcgaagttgt
aatcgtatgtcttcgcacacagagacgtcaagtttcttacaaacattaacgggacgctta
ccaaccaaaaagggaaaggaagatgagttagaaaaattgtcactcttactttttcatgag
gagctggctttgcagtgggttgtttgcagtggcagcgttcgggaatcagctttgcaacaa
gcctggttcttttttgagttaatggtaaagagcatggtacatcatttatacttcaatgat
aaacttgatgctccaaggaaaagtcgttttccagaacgttttatggatgacattgcagct
cttgtcagcacgattgctagtgatatagtttcacgatttcagaaggacacagaaatggtt
gagagactcaatacaagccttgcattctttctcaatgatctgttgtctgttatggacaga
ggatttgtttttagccttataaagtcctgctataaacaggtgtcttcaaagctttactca
ttaccgaatccgagcgttctggtgtccttgaggctggattttctgcgaatcatctgcagt
catgagcactatgttacattaaacttaccctgtagcttacttactccacctgcatctcca
tcaccttctgtttcttctgcaacatctcagagttctggattttctacgaatgtacaagac
cagaagatcgcaaatatgtttgaattgtcggtgcctttccggcaacagcattatttggcg
ggtcttgtgttaacagagctggctgtcattttagaccctgatgctgaaggactgtttgga
ttgcataagaaagtcatcaatatggtacacaatttactttccagtcacgactcagacccg
cggtactctgacccccagataaaggctcgagtggccatgttgtatctacctctgattggt
attattatggaaactgtacctcagctgtatgattttacagaaactcacaatcaacgagga
agaccaatttgtatagcccctgatgactatgaaagtgagagcggaagtatgataagccag
actgttgccatggcaatcgcagggacatcggtccctcagctaacaaggcctggcagtttc
ctcctcacatcaacgagtggcagacaacacactaccttttcagcagaatcaagtcgaagc
cttttgatctgtctactttgggttctcaaaaatgcagatgaaacagttctacagaagtgg
tttacagatctctcggtcttgcagctaaaccggctgttagatctgctttatctctgtgta
tcttgctttgagtataaagggaaaaaagtgtttgaaagaatgaacagcttgacctttaag
aaatcaaaagacatgagagcaaagcttgaagaagccattcttgggagcataggtgctagg
caagaaatggtgcgtcgaagccgaggacagctcgagagaagcccatctggaagtgccttt
ggaagtcaagaaaatttgaggtggagaaaagatatgactcactggcgtcaaaacacagag
aagcttgacaaatcaagagcagacattgaacatgaagcactgattgatggaaacctggct
acagaagcaaacctcatcattttggatacattagagattgttgttcagaccgtttctgta
acagaatccaaagagagcattcttggtggagtgctgaaagtgctgctacacagcatggcc
tgcaaccagagtgcggtgtatctacagcactgttttgctacacagagagccttggtttca
aagtttcctgaactcttatttgaagaagagacagagcagtgtgctgatttatgcctcagg
cttctccgacactgtagcagtagcatcagtacgatacggtcacacgccagtgcttccctt
tacctactaatgaggcaaaactttgagattgggaataactttgccagggttaaaatgcag
gtaacaatgtcactatcctccttggtgggcacatctcagaattttaatgaagaattctta
agacgttctctaaagactatcttgacatatgctgaagaagatctggaattgagggaaaca
acatttcctgatcaggttcaggatctggttttcaatctccatatgatcctttctgatact
gtgaaaatgaaggaacaccaggaggatcctgaaatgttgattgacctaatgtacagaatt
gccaagggttaccagacttctccagatctgcgattgacctggttgcagaacatggctggc
aagcactcagaacgaagcaatcatgctgaagctgcacagtgtctggtccactcagcagca
cttgttgctgaatatttgagcatgctggaggaccggaaataccttcctgtgggatgtgta
acatttcagaatatttcatctaatgttttagaagaatctgcagtctcagatgatgtggta
tctccagatgaagaaggtatctgctctggaaaatactttactgagtcaggacttgtggga
ttgctggaacaagcagctgcttctttctctatggctggcatgtatgaagcagttaatgag
gtttacaaagtacttattcctgttcatgaagctaatcgcgatgcaaagaaactgtccaca
attcatggtaaacttcaagaagcattcagcaaaattgttcatcagagtactggctgggag
cggatgtttggcacctattttcgtgttggtttttatggaaccaagttcggggatttggat
gaacaagaatttgtttacaaggagcctgcaataaccaaacttgcagagatatctcacaga
ttggagggattttatggcgaaagatttggagaggatgtggttgaagtaatcaaagactct
aatcctgtagacaagtgtaaattagatcctaacaaggcatatattcagattacctatgtg
gagccatactttgacacatatgagatgaaggacagaatcacttatttcgacaaaaattat
aatcttcgccgcttcatgtactgtacaccctttactttagatggccgtgcccatggggaa
cttcatgaacaattcaaaaggaagaccattctgactacatctcatgcctttccttatatt
aaaacaagggtcaatgtcactcacaaagaagagatcatcttaacaccaattgaagttgct
attgaggacatgcagaaaaagacacaggagttggcatttgcaacacatcaggatcccgcc
gaccccaaaatgcttcagatggtactccagggatctgtaggcacaacagttaatcagggg
cctttggaagttgcccaggtttttctctctgaaatacctagtgacccaaagctcttcaga
catcataataaactgcgactctgctttaaagattttactaaaaggtgtgaagatgcctta
agaaaaaataagagcttaattgggccagatcaaaaggagtatcagagggaactggagaga
aactatcatcgccttaaagaggccctacagccactgatcaacagaaagatccctcagtta
tacaaggcagtattgcctgttacctgccacagagattccttcagtcgaatgagtcttcgc
aaaatggatctctaa

DBGET integrated database retrieval system