KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032695Help
Entry
101032695         CDS       T04350                                 

Gene name
ERP44
Definition
(RefSeq) endoplasmic reticulum resident protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101032695 (ERP44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101032695 (ERP44)
Membrane trafficking [BR:sbq04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    101032695 (ERP44)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101032695 (ERP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin HyaE OST3_OST6 Thioredoxin_2 Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 101032695
NCBI-ProteinID: XP_003940134
UniProt: A0A2K6TFG3
Position
Unknown
AA seq 406 aa AA seqDB search
MNPALFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRF
SQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSEIAQRYRISKYPTLKLFRNGMMMK
REYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRSIIGYFEQKDSDNYRVFER
VANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDK
CVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHAD
CDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREF
HHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctgccctcttcctatccttacccgacctcagatgctccctgctgctcctggta
acttgggtttttactcctgtaacaactgaaataacaagtcttgatacagagaatatagat
gaaattttaaacaatgctgatgttgctttagtaaatttttatgctgactggtgtcgtttc
agtcagatgttgcatccaatttttgaggaagcttccgatgtcattaaggaagaatttcca
aatgaaaatcaagtagtgtttgccagagttgattgtgatcagcactctgaaatagcccag
agatacaggataagcaaatacccaactctcaaattgtttcgtaatgggatgatgatgaaa
agagaatataggggtcagcgatcagtgaaagcactggcagattacatcaggcaacaaaaa
agtgaccccattcaagaaattcgggacttagcagaaatcaccactcttgatcgcagcaaa
agaagtatcattggatattttgagcaaaaggactcggacaactatagagtttttgaacga
gtagcgaatattttgcatgatgactgtgcctttctttctgcatttggggatgtttcaaag
ccagaaagatacagtggagacaacataatctacaaaccaccagggcattctgctccagat
atggtgtacttgggagctatgacaaattttgatgtgacttacaattggattcaagataaa
tgtgttcctcttgtccgagaaattacatttgaaaatggagaggaattgacagaagaagga
ctgccttttctcatactctttcacatgaaagaagatacagaaagtttagaaatattccag
aatgaagtagctcggcaattaataagtgaaaaaggtacaataaactttttacatgccgat
tgtgacaaatttagacatcctcttctgcacatacagaaaactccagcagattgtcctgta
attgctattgacagctttaggcatatgtatgtgtttggagacttcaaagatgtactaatt
cctggaaaactcaaacaattcgtatttgacttacattctggaaaactccacagagaattc
catcatggacctgacccaactgatacagccccaggagagcaagcccaagatgtagcaagc
agtccacctgagagctccttccagaaactagcacccagtgaatataggtatactctattg
agggatcgagatgagctttaa

DBGET integrated database retrieval system