KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032947
Entry
101032947         CDS       T04350                                 

Gene name
CCNK
Definition
(RefSeq) cyclin-K
  KO
K23326  cyclin K
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101032947 (CCNK)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101032947 (CCNK)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C PDZ_3 Cyclin_C_2
Other DBs
NCBI-GeneID: 101032947
NCBI-ProteinID: XP_010337779
UniProt: A0A2K6UEQ5
Position
Unknown
AA seq 472 aa
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDV
GTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTA
RSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQK
LVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQ
DVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQPSQPSQGSEPA
QPQQKDPQQPAQQQQPAPQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEPPPPKIPKIET
THPPLPPAHPPPDRKPPLAAALGEAEPPGPVDATDLPKVQIPPPAHPAPVHQPPPLPHRP
PPPPPSSYITGMSTTSSYMSGEGYQSLQSMMKAEGPSYGALPPAYGPPTHLP
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgaaggagaataaagaaaattcaagcccttcagtaacttcagcaaacctggaccacaca
aaaccatgttggtactgggataagaaagacttggctcatacaccctcacaacttgaagga
cttgatccagccactgaggcccggtaccgccgagagggcgctcggttcatcttcgatgtg
ggcacacgtttggggctacactatgataccctggcaactggaataatttattttcatcgc
ttctatatgtttcattccttcaagcaattcccaagatatgtgacaggagcctgttgcctc
tttctggctgggaaagtagaagaaacaccaaaaaaatgtaaagatatcatcaaaacagct
cgtagtttattaaatgatgtacagtttggccagtttggagatgacccaaaggaggaagta
atggttctggagagaatcttactgcagaccatcaagtttgatttacaggtggaacatcca
taccagttcctactcaaatatgcaaagcaactcaaaggtgataaaaacaaaattcaaaag
ttggttcaaatggcatggacatttgtaaatgacagtctctgcaccaccttgtcactgcag
tgggaaccagagatcatagcagtagcagtgatgtatctcgcaggacgtttgtgcaaattc
gaaatacaagaatggacctccaaacccatgtataggagatggtgggagcagtttgttcaa
gatgtcccagtcgacgttttggaagacatatgccaccaaatcctggatctttactcacaa
ggaaaacaacagatgcctcatcacaccccccatcagctgcagcagcccccgtctcttcag
cctacacctcaagtgccgcaagtacagccgtcacagccgtctcaaggctccgaaccagcc
cagccccagcagaaggacccccagcagccagcccagcagcagcagccagccccacagccc
aagaaaccctctccacagcccagttctccccgacaggttaagcgagccgtggttgtgtct
cccaaagaagagaacaaagcagcagaaccaccaccacctaaaattcccaagattgagacc
actcacccaccgttgcctccagcccacccacctccagaccggaagcctcccctcgctgct
gccttaggtgaggctgagccgccaggccctgtggatgccactgacctccccaaagtccag
attcctcctccggcccacccggctcctgtgcaccagccaccaccgctgccacatcggccc
ccgcccccacccccctccagctacataacggggatgtccaccaccagctcctacatgtct
ggagagggctaccagagcctgcagtccatgatgaaggccgaggggccctcctacggcgcc
ctgccccctgcctatggcccgcccacacacctgccc

DBGET integrated database retrieval system