KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033358
Entry
101033358         CDS       T04350                                 

Gene name
CTDSP1
Definition
(RefSeq) carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 isoform X3
  KO
K15731  carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase [EC:3.1.3.16]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101033358 (CTDSP1)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101033358 (CTDSP1)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101033358 (CTDSP1)
Protein phosphatases and associated proteins [BR:sbq01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   101033358 (CTDSP1)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101033358 (CTDSP1)
SSDB
Motif
Pfam: NIF
Other DBs
NCBI-GeneID: 101033358
NCBI-ProteinID: XP_003925585
Position
Unknown
AA seq 262 aa
MPGHTCGILKASVHPAPNWGLIISGDQRSAASQKPRSRGILHSLFCCVCRDDGEALPAHS
GSPLLVEENGAIPKTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVE
IDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRE
SCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLP
FFEQLSRVDDVYSVLRQPRPGS
NT seq 789 nt   +upstreamnt  +downstreamnt
atgcctgggcacacatgcgggattctaaaggccagtgtgcacccagcccccaactggggc
ctcattatttcaggtgaccagaggtcagcagcttcccagaagccccgaagccggggcatc
ctccactcgctgttctgctgcgtctgccgggacgatggggaagccttgcctgcccacagt
gggtcgcccctgcttgtggaggagaatggtgccatccccaagaccccagtccagtacctg
ctccccgaggccaaggcccaggactcagacaagatctgcgtggtcatcgacctggatgag
accctggtgcacagctccttcaagccagtgaacaacgccgacttcatcatccctgtggag
attgatggggtggtccaccaggtctacgtgctgaagcggcctcacgtggatgagttcctg
cagcgaatgggcgagctctttgaatgtgtgctgttcactgccagcctcgccaagtacgca
gacccagtagctgacctgctggacaagtggggggccttccgtgcccggctgtttcgagag
tcctgtgtcttccaccgggggaactatgtgaaggacctgagccggctgggcagagacctg
cggcgggtactcatcctggacaactcgcccgcctcctacgtcttccatccggacaatgcc
gtaccggtggcatcgtggtttgacaacatgagtgacacagagctccacgacctcctcccc
ttctttgagcaactcagccgcgtggacgacgtatactcagtgctcaggcagcctcggcca
gggagctag

DBGET integrated database retrieval system