KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033529Help
Entry
101033529         CDS       T04350                                 

Gene name
CPT2
Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00071  Fatty acid degradation
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101033529 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101033529 (CPT2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101033529 (CPT2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101033529 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 101033529
NCBI-ProteinID: XP_010347167
UniProt: A0A2K6UI85
Position
Unknown
AA seq 658 aa AA seqDB search
MVPRLLLRAWPRCPAVGPEVPSRRLSAGSGPGQYLQRSIVPTMHYQDSLPRLPIPKLEDT
IRRYLNAQKPLLDDGQFRKTEQFCKSFENGIGKELHKQLVAQDKQNKHTSYISGPWFDMY
LSARDSVVLNFNPFIAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNP
AKSDTDTFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSQDELFTDDKA
RHLLVLRKGNFYIFDVLDQDGNIVSPSEIQAHLKYILSDGSPAPEFPLAYLTSENRDIWA
ELRQKLLSSGNEEGLRKVDSAVFCLCLDDFPIKDLIHLSHNMLHGDGTNRWFDKSFNLII
AKDGSAAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAITPQSQPATTDSIDAVQKLNFKLS
DALKTGITAAKEKFVATMKTLTIDCVQFQRGGKEFLKQQKLSPDAVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASIYTKRCSEAFVREPSKHSAGELQQMMAECSKYHG
QLTKEAAMGQGFDRHLFVLRYLAAAKGIILPEFYLDPAYGQINHNVLSTSTLSSPAVSLG
GFAPVVPDGFGIAYAVHDNWIGCNVSSYPGRNAREFLQCVQKAFEDIFDALEGKSIKS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggtgccccgcctactgctgcgcgcctggccccggtgccccgcggttggcccggaagtc
cccagtcggcgccttagcgccggctccgggcccggccagtacctgcagcgcagcatcgtg
cccaccatgcactaccaggacagcctgcccaggctgcctattcccaaacttgaagacacc
atcaggagatacctcaatgcacagaagcctctcttggatgatggccagttcaggaaaacg
gaacaattttgcaagagttttgaaaatgggattggaaaagaactgcacaagcagctggtt
gctcaggacaaacagaataaacatacaagctacatttcaggaccttggtttgatatgtac
ctatctgctcgagactccgttgttctgaactttaatccatttatcgctttcaatcctgac
ccaaaatctgagtacaacgaccagctcacccgggcaaccaacatgactgtttctgccatc
cggtttctgaagacactccgggctggccttctggagccagaagtgttccacttgaatcct
gcaaaaagtgacactgacaccttcaagagactcatacgctttgtgccttcctctctgtcc
tggtacggggcctacctggtcaatgcatatcctctggatatgtcccagtattttcggctg
ttcaattcaactcgtttacccaagcccagtcaggatgaactcttcactgatgacaaggcc
agacacctcctggtcctaagaaaaggaaatttttatatcttcgatgtcctggatcaagat
gggaacattgtgagcccctcggaaatccaggcccatctgaagtacattctctcagacggc
agccccgcccctgagtttcctctggcatacctgaccagtgagaaccgagacatctgggca
gagctcaggcagaagctgctgagtagtggcaatgaggagggcctgaggaaagtggactct
gccgtgttctgcctctgcctagatgacttccccattaaggaccttatccacttgtcccac
aatatgctgcacggggacggcactaaccgctggtttgataaatcctttaacctcattatc
gccaaggatggctctgctgctgtccactttgagcactcttggggtgatggtgtggcagtg
ctcagattttttaatgaagtgtttaaagacagcactcagacccctgccatcactccacag
agccagccagccaccactgactctattgatgccgtgcagaaactcaactttaagctgagt
gatgccttaaagactggcatcacggctgctaaggaaaagtttgttgcaaccatgaaaacc
ctcactatcgactgcgtccagtttcagagaggaggcaaagaattcttgaagcagcagaag
ctgagtcctgacgcagtggcccagctggccttccagatggccttcctgcggcagtacggg
cagacagtggccacttacgagtcctgcagcactgccgcattcaagcacggccgcactgag
accatccgcccggcctccatctatacaaagaggtgctctgaggcctttgtcagggagccc
tccaagcacagtgctggtgagcttcagcagatgatggctgagtgctccaaataccatgga
cagctgaccaaagaagcagcaatgggccagggctttgaccgacacttgtttgttctgcgg
tacttggcagcagccaaaggaatcatcttgcccgagttctacctggaccctgcatacggg
cagataaatcacaatgtcctgtctacaagcactctaagcagcccagcggtgagccttggg
ggctttgcccccgtggtccctgatggctttggcattgcgtatgctgttcatgacaactgg
ataggctgcaatgtgtcttcctacccaggccgcaatgcccgggagtttctccaatgtgtg
cagaaggccttcgaagacatttttgatgccttagaaggcaaatccatcaaaagctaa

DBGET integrated database retrieval system