KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034781Help
Entry
101034781         CDS       T04350                                 

Gene name
PIK3C2B
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00562  Inositol phosphate metabolism
sbq01100  Metabolic pathways
sbq04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101034781 (PIK3C2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101034781 (PIK3C2B)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     101034781 (PIK3C2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3K_C2 PI3K_rbd PI3_PI4_kinase PX C2 HEAT_2
Motif
Other DBs
NCBI-GeneID: 101034781
NCBI-ProteinID: XP_010347305
Position
Unknown
AA seq 1615 aa AA seqDB search
MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRQDKEESRAKQNADPSLISW
DEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQGPQPGPDPWPK
GSLSGDYLYIFDGSDGGVSLSPGPGDIEGSCKKLSPPPLPPRTSIWDTPPLPPRKGSPSS
SKISQPNDINTFSLVEQLPGKLLGNQILEEEEVPGGRGQGRLLGSVDYDGINDAITRLNL
KSTYDAEMLRDATRGWKEGRGTLDFSKDTSGKPVARSKTMPPQVPPRTYASRYANRKNAT
PGKNRRISAAPVGSRSHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYSLTGY
VWSAVTPSPEHLGDEVNLKVTVLCDSLREALTFTCNCSSTVDLLIYQTLCYTHDDLRNVD
VGDFVLKPCGLEEFLQNKHALGSHEYIQHCRKFDIDIRLQLMEQKVVRSDLARTVNDDQS
PSTLNYLVHLQERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAIC
NALAAVETPEITNALNQLPPCPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELY
CNTFNADFQTAVPGSCKHDLVQEAYHFSGALAFTVYATHRIPITWATSYEDFYLSCSLSH
GGKELCSPLQTRRAHFSKYLFHLIIWDQQICFPVQVNRLPRETLLCATLYALPIPPPGSS
SEANKQRRVPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQESPSARWSAPNFHQPDSVI
LQIDFPTSAFDIKFTSPAGDKFSPRYEFGSLREEDQRKLKDIMQKESLYWLTDADKKRLW
EKRYYCHSEVSSLPLVLASAPSWEWACLPDIYALLKQWTHMNHQDALGLLHATFPDQEVR
RMAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKD
GLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNALAKLAQQVREAAPSARQGILR
TGLEEVRQFFILNGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLSFQNVDPLGENVRV
IFKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVIFRCFSTGRGRGMVEMIPNAETLRK
IQVEHGVTGSFKDRPLADWLQKHNPAEDEYEKVGLGAGERIWGKLPPGAAHMAGFLLRVD
LLSVCSPWLRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDLCCQAYNLIRKHTHLFLNLL
GLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLIESSLGSVATKLNFFIHNLA
QMKFTGSDDRLTLSFASRTHTLKSSGRITDVFLCRHEKIFHPSKGYIYVVKVMRENAHEA
TYIQRTFEEFQELHNKLRLFFPSSHLPSFPSRFVIGRSRGEAVAERRREELNGYIWHLIH
ATPEVAECDLVYTFFHLLPRDEKAMGTSPAPKSSDGTWARPVGKVGGEVKLSISYKNNKL
FIMVMHIRGLQLLQDGNDPDPYVKIYLLPDPQKTTKRKTKVARKTCNPTYNEMLVYDGIP
KGDLQQRELQLSVLSEQGFWENVLLGEVHIRLRELDLAQEKTGWFALGSRSHGTL
NT seq 4848 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgactcagggcaatggggagcactggaagtccctggagtctgtgggcatcagc
cgcaaagagctggcgatggccgaagccctgcagatggagtatgatgccctgtcccggctc
cggcaggacaaggaggagagcagagccaagcagaacgcagacccctctctcatcagctgg
gatgagcctggggtagacttctacagcaagccagcaggaaggcggaccgacctcaagctg
ttacgcggtctctctggctctgatcctaccctcaactacaactcactctccccacaggaa
gggccgcccaaccactctacctcccaagggccccagcctggcccagatccctggcccaaa
ggctccctgtctggagactatctctacatttttgatggttcagatgggggagtctctttg
tccccaggtccaggagacatagagggctcttgcaagaaactatccccacctcctctgcct
ccccgaacctctatctgggatacccctcccctacctcccagaaaggggtccccgtcatcc
tctaagatctcccagcccaatgacatcaacactttctctttggtcgaacaattgccagga
aaactgctagggaaccagatcctggaagaggaagaggtgccaggaggtaggggtcagggc
cgcctgctggggtctgtggactatgatggcatcaacgatgcaattacaaggctcaacttg
aagtcaacctatgacgcggagatgttgcgggatgccaccaggggctggaaggagggccga
gggaccctggacttcagcaaagacacctctggaaaacccgtggcccggagcaagactatg
ccccctcaggtgcccccccgcacctatgcctcccgctatgccaaccgaaagaatgcgaca
cctggcaagaaccgccggatttctgcagctccggtgggctcccggtcccacaccgttgcc
aatggccatgagttgtttgaggtctcagaagagagagatgaagaggttgctgcattttgc
cacatgctggatatccttcgatctggctctgacatccaggactactccctcactggctat
gtttggagtgctgtcacccctagtccagagcacctgggggatgaggtcaacctgaaggtg
acggtgttgtgtgacagccttcgagaagcactcacttttacctgcaactgttcctccact
gtagacttgcttatctaccagaccctgtgctacacccatgatgacctgaggaacgtggac
gtgggtgactttgtgctgaagccctgtgggctggaggagttcctacagaacaagcacgcc
ttgggcagccatgagtacatccaacactgccgcaagtttgacattgacattcggctgcag
ctgatggagcagaaggtcgtgcgcagtgacctggcccggacggtgaatgatgaccagagc
ccctccaccttgaactacctcgtccatctccaagagaggcccgtcaagcagaccatcagt
aggcaggccctgagtcttctgtttgacacttaccacaatgaggtggatgccttcctgctg
gctgacggggacttcccgctgaaggctgacagggtggtccagtccgtcaaggccatctgc
aacgccctggccgctgtggaaacccctgagatcaccaatgctctcaaccagctgcccccc
tgcccctcccgcatgcaacctaaaattcagaaggatcccagcgtcttggctgtgagggaa
aaccgagagaaggtcgtggaagccctgaccgctgccatcttggacctggtggagctgtac
tgcaacacattcaacgcagacttccagacggcagtacccggaagctgcaagcatgacctg
gtccaggaggcctaccatttctccggggccctggccttcactgtctatgccactcatcgt
atccccatcacctgggccaccagctatgaagatttctacctctcctgctccctcagccat
ggtggcaaggagctgtgcagccccctgcagacccgaagagcccacttctccaagtacctc
ttccacctcatcatctgggaccagcagatctgcttcccggtgcaggtgaaccggctgcct
cgggagactctgctgtgtgccactctgtatgctctgcccatccccccaccggggagctcc
tcggaggccaataaacagcggagggtgcccgaagccttgggctgggtcactaccccactc
ttcaacttcaggcaggttctgacctgtggccggaagcttctgggtctgtggccagcaaca
caggaaagccctagtgcccgttggagtgcaccgaacttccaccagccagacagcgtcatc
ctgcagattgacttccccacctcggcctttgacatcaagttcaccagccccgctggagac
aagttcagcccccgctatgagtttggcagcctccgggaagaagaccagcgcaagcttaaa
gacatcatgcagaaggagtccctgtactggctcactgatgctgacaagaagcgcctttgg
gagaagcgatattactgccactcggaggtgagctcactccccctggtgctcgccagcgcc
cccagctgggagtgggcttgcctgcccgacatctatgctctcctgaagcagtggacccac
atgaaccaccaggatgccctggggctcctgcatgccaccttcccggaccaggaggtgcgt
cgtatggctgtgcagtggattggctcactctcagatgccgagctgctggactacctgccc
cagctggtacaggccctaaagtacgagtgctacctggacagcccgttggtgcgcttcctc
ctgaaacgagctgtgtccgacttgagagtgactcactacttcttctggttgctgaaggac
ggcctcaaggactctcagttcagcatccgctaccagtatctgctggcagccttactgtgc
tgctgtggcaaggggctcagagaagagtttaaccgccagtgctggcttgtcaacgccctg
gccaaactggcccagcaggtccgggaggcagccccatcggcaaggcagggaatcctccgc
acgggcctggaggaggtgaggcagttctttatcctcaatggctcgtgccgtctgccgctc
agccccagtctgctggttaagggaatcgtgcccagggactgttcctacttcaactccaat
gctgtccccctcaaactctccttccaaaatgtggatcccctgggtgagaacgtccgtgtc
atcttcaagtgtggggacgaccttcgccaggacatgctaacgctgcagatgattcgcatc
atgagcaagatctgggtccaggaggggctggacatgcgcatggtcatcttccgctgcttc
tccactggccggggcagagggatggtggagatgatccctaatgccgagaccctacgtaag
atccaggtggagcatggggtgaccggctcgttcaaggaccggcccctggcagactggctg
cagaaacacaaccctgcggaggacgagtatgagaaggtagggttgggggctggggagcgc
atctgggggaagctgccccctggtgcagcccacatggcgggcttcctcctccgtgttgac
cttctatctgtatgttccccttggctcagggaccgtgccccctttgtcttcacctcggac
atggcgtatgtcatcaacgggggtgacaagccttccagccgcttccatgattttgttgac
ctttgctgccaagcctacaacctcattcgcaagcatacccacctcttcctcaaccttctg
ggcctgatgttgtcctgtgggatccctgagctctcagacctggaagacctcaagtatgtg
tatgatgccctgaggcctcaggacacagaggcgaatgccactacgtacttcactaggttg
attgagtccagcctgggcagtgtagccacaaagctcaattttttcatccataatctggct
cagatgaagttcacgggctcagatgaccggctgaccctctcctttgcctcccgaacacac
actctcaagagctctggccgcatcacggatgtcttcctctgccgccatgagaagatcttc
caccccagcaaaggctatatatacgtggtaaaggtgatgcgagagaatgctcacgaggcc
acctatatccagcggacctttgaggagttccaggaattgcacaataagctgcggctgttc
ttcccttcttcccacttgcccagcttccctagtcgcttcgtgattggccgctcgcgggga
gaggcggtggccgagcggcggagggaggagctaaacggctacatctggcacttgatccac
gcaacccccgaggtggccgagtgtgatttggtgtacaccttcttccacctgctgccccgg
gatgagaaggctatgggcaccagcccagctcctaagtcctcagatggcacatgggcccgg
cccgtcggaaaggtgggaggggaggtgaagctgtccatctcctacaaaaacaataagctc
ttcatcatggtgatgcatattcggggcttgcagctgctccaggatggaaatgaccctgac
ccctatgtgaaaatttacctccttcctgaccctcaaaaaaccactaagaggaaaaccaaa
gtggcccggaaaacctgcaaccctacctacaatgagatgttggtgtatgatgggattccc
aagggagacctgcagcagcgggagctccagctgagcgtgctgagtgagcagggattctgg
gagaacgtccttctcggtgaggtacacatccgcctacgagagctggacctggctcaggag
aagactggctggttcgcactgggatctcgaagtcatggcaccttgtga

DBGET integrated database retrieval system