KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034990
Entry
101034990         CDS       T04350                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbq01002]
    101034990 (ERAP1)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     101034990 (ERAP1)
Peptidases and inhibitors [BR:sbq01002]
 Metallo peptidases
  Family M1
   101034990 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 101034990
NCBI-ProteinID: XP_010338530
UniProt: A0A2K6SUT1
Position
Unknown
AA seq 941 aa
MVFPSIKWSLATISFLLSSLLALLTVSTPSWCQSSEASPTGSNGTPFPWNKIRLPEYIVP
VHYDLLIHANLTKSTFWGTTEVEITTSQPTSTIILHSHHLQISKAILRKGAGERLSEEPL
QVLEHQAQEQIVLLAPEPLLVGLPYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILAST
QFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTIAEGLIEDHFDVTV
KMSTYLVAFIISDFASVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMIVAHELAHQWF
GNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFSAMEVDALNSSHPVS
TPVENPAQIREMFDDVSYDKGACILNMLREYLGADAFKIGIVQYLQKHSYKNTKNEDLWD
SMASICPTDGIQEMDGFCSRSQHSSSSSHWHQEGLDVKTMMNTWTLQKGFPLITITVSGR
NVHMKQEHYLKGSDGTPDTGYLWHVPLTFITSKSDTVHRFLLKTKTDVLILPEEVEWIKF
NVGMSGYYIVHYENDGWDSLTGLLKATHTAISSNDRASLINNAFQLVSIGKLSIEKALDL
SLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRGLIDKQTWTDEG
SVSERMLRSQLLLLACVRKYQPCVHRAEDYFRKWKESNGNLSLPVDVTLAVFAVGAQSTE
GWDFLYSKYQSSLSSTEKNEIEFALCITQNKEKLQWLLDESFKGDNIKTQEFPKILTFIG
RNPVGYPLAWQFLRENWNKLVQKFELGSPSIAHMVIGTTNQFSTRTRLEEVKGFFSSLKE
NGSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQSEKLEFL
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggtatttccgtccatcaagtggtcccttgcaacaatatcatttctgctttcctcactg
ttggctctcttaactgtgtccactccttcatggtgtcagagcagtgaagcatctccaaca
ggtagtaatgggacaccatttccttggaataaaattcgacttcctgagtacatcgtccca
gttcattatgatctcctgatccacgcaaacctcacgaagtctaccttctggggaaccaca
gaggtagaaatcacaaccagtcagcccaccagcaccatcattctgcatagtcaccacctg
cagatatctaaggccatcctcaggaagggagctggagagaggctgtcagaagaaccgctg
caggtcctggaacaccaggctcaggagcaaatcgtgctgctggctcccgagcccctcctt
gtcgggcttccgtacacagttgtcattcactatgctggcaatctttcagagactttccat
ggattttacaaaagcacctacagaaccaaggaaggggaactgaggatacttgcatcaaca
caatttgaacccactgcagctagaatggcctttccctgctttgatgaacctgccttcaaa
gcaagtttctcaatcaaaattagaagagagccaaggcacctagccatctccaatatgcca
ctggtgaaatctgtgactattgctgaaggactcatagaagaccattttgatgtcactgtg
aagatgagcacctatctggtagccttcattatttcagattttgcgtctgtcagcaagatg
accaaaagtggagtcaaggtttctgtatatgctgtgccagacaagataaatcaagcagat
tatgcactggatgctgcagtgactcttctagaattttatgaggattatttcagcatacca
tatcccctacccaaacaagatcttgctgctattcccgactttcagtctggtgctatggaa
aactggggactgacaacatatagagaatctgctctgttgtttgatgcagaaaagtcttct
gcatcaagtaagcttggcatcacaatgattgtggcccatgaactggctcaccagtggttt
gggaacctggtcactatggaatggtggaatgacctttggctaaatgaggggtttgccaaa
tttatggagtttgtgtctgtcagcgtgacccatcctgaactgaaagttgaagattatttc
tttggtaaatgtttcagtgcgatggaggtagatgctttaaattcctcacaccctgtgtct
acacctgtggagaatcctgctcagatccgggagatgtttgatgatgtttcttatgataag
ggagcttgtattctgaatatgctaagggagtatcttggtgctgatgcatttaaaattggc
attgtacagtatctccagaagcatagctataaaaatacaaaaaacgaggacctgtgggat
agtatggcaagtatttgccctacagatggcatacaagagatggatggcttttgctctaga
agtcagcattcatcttcatcctcacactggcatcaggaaggcctggatgtgaaaaccatg
atgaacacctggacactgcagaagggttttcccctgataaccatcacagtgagcgggagg
aacgtgcacatgaagcaagagcactacctgaagggatctgacggcaccccggacactggg
tacctgtggcatgttccattgacattcatcactagcaaatcagacacagtccatcgattt
ttgctgaaaacaaaaacagatgtgctcatccttccagaagaggtggaatggatcaaattt
aatgtaggtatgagtggctattacattgtgcattatgagaatgacggatgggactctttg
accggccttttaaaagcaacacacacagcaatcagcagtaatgatcgggcgagtctcatt
aacaatgcatttcagcttgtcagcattgggaagctgtccattgaaaaggccttggattta
tccctgtacttgaaacatgaaactgaaattatgcccgtgtttcaagggttgaatgagctg
attcctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcaattcaag
gccttcctcatcaggctgctaaggggcctcattgataagcagacatggacagacgagggc
tcagtctcagagcgaatgctgcggagtcagctgctcctcctcgcctgtgtgcgcaagtat
cagccgtgcgtacacagggcagaagactatttcagaaagtggaaggaatccaatggaaac
ttgagcctgcctgtcgacgtgaccctggcagtgtttgctgtgggggcccagagcacggaa
ggctgggattttctttatagtaaatatcagtcttctttgtctagtactgagaaaaacgaa
attgaatttgccctctgcataacccaaaataaggaaaagcttcaatggctactagatgaa
agctttaagggtgataacataaaaactcaggagtttccaaaaattctaacattcattggc
aggaacccagtaggatatccattggcctggcaatttctgagggaaaactggaacaaactt
gtacaaaagtttgaacttggctcaccttccatagcccacatggtaataggtacaacgaat
caattctccacaagaacacggcttgaagaggtaaaaggattcttcagctctttgaaagaa
aatggttctcagctccgttgtgtccagcagacaattgaaaccattgaagaaaatatccgt
tggatggataagaattttgataaaattagagtatggctgcagagtgaaaagctagaattt
ctgtaa

DBGET integrated database retrieval system