KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035077Help
Entry
101035077         CDS       T04350                                 

Gene name
GUCY2F
Definition
(RefSeq) retinal guanylyl cyclase 2
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00230  Purine metabolism
sbq01100  Metabolic pathways
sbq04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101035077 (GUCY2F)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    101035077 (GUCY2F)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101035077 (GUCY2F)
Enzymes [BR:sbq01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101035077 (GUCY2F)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   101035077 (GUCY2F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Guanylate_cyc Pkinase_Tyr Pkinase HNOBA Kinase-like
Motif
Other DBs
NCBI-GeneID: 101035077
NCBI-ProteinID: XP_003935911
UniProt: A0A2K6SHV1
Position
Unknown
AA seq 1108 aa AA seqDB search
MFLGFCSFSRLVFRFAAFRKLLGHHGLASSKFLWCLCLLAVISLPRQVWTLPYKIGVVGP
WACDSLFSKALPEVAAQLAIERINRDPSFDLSYSFEYVILNEDCQTSRALSSFISHHQMA
SGFIGPTNPGYCEAASLLGNSWDKGIFSWSCVNYELDNKNSYPTFSRILPSPIRVLVTVM
KYFQWAHAGVISSDEDIWVHTANRVASALRSHGLPVGVVLTTGQDSQSIRKALQRIHQAD
RIRIIIMCMHSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYQVLRN
NPKLREAYDAVLTITVESQEKTFYQAFTEAAVRGEIPEKLEFDQVSPLFGTIYNSIYFIA
KAMNNAMKENGQAGAASLVQHSRNMQFYGFNQLIRTDSNGNGISEYVILDTNWKEWELHS
TYTVDMETELLRFGGTPIHFPGGRPPRADAKCWFAEGKICHGGIDPAFAMMVCLTLLIAL
LSINGFAYFIRRRINKIQLIKGPNRILLTLDDVTFINPHFGSKRGSRASVSFQITSEVQS
GRSPRLSFSSGSLTPATYENSNIAIYEGDWVWLKKLPSGDFGDVKSIKSSASDVFEMMKD
LRHENINPLLGFFYDSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKY
LHHREFVHGRLKSRNCVVDGRFVLKVTDYGFNDILEMLRLSEEESSVEELLWTAPELLRV
PRGSRLGSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAQEIINRLKKPPPVYRPVVPPEHA
PPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIR
ERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMS
EPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDI
LSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPY
RIHVSLSTVTILRNLSEGYEVELRGRTELKGKGTEETFWLIGKKGFTKPLPVPPPVGKDG
QVGHGLQPVEIAAFQRRKAERQLVRNKP
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgggattctgtagtttttctcgccttgtattccggtttgcggctttcaggaaa
ctgctgggacaccatggccttgcatcctctaagttcctgtggtgcttgtgcctcctagct
gtcatatcccttcctcggcaggtgtggacactcccctacaagataggggtggtgggccct
tgggcttgtgattcactgttttcaaaggccctgcctgaggttgctgcgcaattagccatt
gagcgaataaaccgggacccatcttttgacctgagttactcttttgaatatgtgattctc
aatgaagactgccagacttcgagggcgctctccagttttatttcccaccaccagatggcc
tcaggatttattggacctacaaaccctggctactgcgaggcagcctcgctcctgggaaac
agctgggacaaagggattttctcttggtcctgtgtgaattatgaattagacaataaaaat
agctacccgaccttttctcggatactcccttctcccatccgggtgctcgtaactgtcatg
aaatatttccagtgggctcatgctggagtcatttcctcagatgaagatatttgggtgcat
acagccaatcgagtcgcaagtgctcttcggagccacggcttacctgtaggggtcgtcctg
accacaggacaagacagccaaagcattcggaaagccctccagaggattcaccaggcagac
agaattcgcataatcatcatgtgtatgcattcagctttgattgggggagagactcagatg
catctcttggaatgtgctcatgatctgaaaatgactgatggaacctacgtctttgttccc
tatgatgccctgctctacagtttaccttataagcacaccccctaccaggtcctaaggaac
aacccaaagctccgggaagcctatgatgcagtgttgaccattacagtggagtcccaagaa
aaaaccttctatcaagcctttacagaggcagcagtaagaggtgaaattcctgagaagttg
gagttcgatcaagtttcaccgttgtttggaaccatctacaattcaatttactttatcgca
aaagccatgaataatgctatgaaagaaaatggacaggctggtgctgccagcctggttcag
cattccagaaacatgcagttctatggattcaaccagttgatcaggacagattcaaatgga
aatggcatttcagaatatgtaatcctggacaccaactggaaagaatgggaactccatagc
acctacacagtggacatggaaacggagctgctacgtttcggaggaacccctattcacttc
cctggtggcaggccccctagagcagatgcaaaatgctggtttgcagaagggaagatctgc
catggaggcatcgaccctgcctttgccatgatggtctgccttactttgcttatagccctg
ctgtctattaatggatttgcttactttataaggcgtcgtataaataaaatccagttgatc
aaaggacccaacagaattctactgactttggacgatgtaacgtttatcaatccccacttt
ggcagtaagaggggaagtcgtgccagtgtaagcttccagattacctcagaggtccaaagc
gggaggtccccaagactctcattttcttcagggagtctaactccagctacatatgaaaac
tccaacatagcgatttatgagggtgattgggtgtggctgaaaaagctcccctctggagac
tttggagacgttaagtccatcaaatcaagtgcaagtgatgtgttcgaaatgatgaaggac
ttgcgtcatgagaatattaaccctttattgggtttcttctatgattcggggatgtttgcc
attgtgacagaattctgttcccgagggagcctagaagacatactgacaaatcaagatgtg
aaacttgactggatgtttaaatcatcactcctgctggatctcatcaagggcatgaagtac
ttacaccacagagagtttgttcatgggaggctaaagtctcgaaactgtgtggtagatggg
cgttttgtactaaaagtgacagattatggctttaacgacatcttagaaatgctgagactc
tctgaagaggaatcttctgtggaagagttgctgtggactgcccctgaactattgagagtc
ccaagaggcagcaggctaggttcgtttgcaggagatgtctatagctttgccatcatcatg
caagaagtgatggtccggggtaccccattctgcatgatggatttgcctgctcaagaaatc
ataaacagacttaagaagcctcctcctgtgtacagaccagtagttcctcctgagcatgcc
cctccagaatgtctccagctgatgaagcagtgctgggctgaggctgcagaacaacggcca
acttttgatgaaatatttaaccagtttaaaacttttaataaagggaagaagaccaatatc
attgattctatgcttcggatgttggagcaatattctagcaacttggaagatttgattcgg
gagcggactgaagagctagaaattgaaaaacagaaaacggaaaagcttctgacacagatg
ctaccaccatcagttgctgaatctctcaaaaagggctgcacagttgaacctgagggcttt
gacctggtcaccttgtacttcagcgacattgtgggcttcacaaccatttcagccatgagt
gagccgattgaggtggtggatcttctgaatgacctgtacacactctttgatgcgataatt
ggcagtcatgatgtctacaaggtagagaccattggagatgcttacatggtggcctcaggc
ctcccaaagaggaatggcagtaggcatgcagctgagattgcaaacatgtccttagatatc
ctgagctctgtgggcactttcaagatgcggcacatgccagaggtgcccgtccgaattcga
attggcctgcactcagggccagttgttgctggagtggtgggcctcaccatgcccagatac
tgcttgtttggagacactgtgaacacagcttctcggatggaatcaacaggcttaccttac
cgcattcatgtcagtctcagcactgttacaattcttcgaaatctgagtgagggctatgaa
gtggagcttcgaggaagaacagagctcaagggcaaaggcacagaggagacattctggctg
attgggaaaaaaggcttcacaaagccccttcctgtgcccccaccagtgggcaaagatggg
caagtgggccatggcctgcaaccagtggagattgcagccttccaaagaagaaaagcagaa
aggcagttggtgagaaacaagccataa

DBGET integrated database retrieval system