KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035908
Entry
101035908         CDS       T04350                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101035908 (AHRR)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101035908 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 101035908
NCBI-ProteinID: XP_010341402
Position
Unknown
AA seq 719 aa
MGELTFLVCTARASCTSLVCAVGFSVNILTHGRPALGVEKSNPSKRHRDRLNAELDHLAS
LLPFPPDVISKLDKLSVLRLSVSYLRVKSFFQAVQEQGSRQLAAGTPSPGDSRPAAGSAV
LEGRLLLESLTGFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFRR
QLHWAMDPPQVVFGQPPPSEAGDDAVLGRLLRAQEWGAGVPTEYSAFLTRCFVCRVRCLL
DSTSGFLTMQFQGRLKFLFGQKKKAPSGAVLPPRLSLFCVAAPVLLPSATEMKMRSTLLR
TKPRADAVAPTDAKVKATASLCESELHGKPSYSAGRSSRESGILVLREQTDTGRWAQVPA
RAPCPCLRGSPDLVLDPKGTSRDREEEQQRVLSRASGATGRREMPGPAKLLPWTAGRRSE
DGARQKLQHSQSGLLSLRPTSRGSCLPYPCVQGTFNASGSGTFRNLPISQPPSPSPSAHA
IRTSRASRDVSEDQVHPPLCHFPQGSLQHPQSEAQRLASRGYPTEDVKLRGMQMPPGGLC
GPTLLLDVPIKMEKDAGSEDAAHGCVPSQVWGLGAGERSCPVTFPTRMPLKTEPDSLHQV
YSAHLGYGVLGAQPHNRATAGRSRELARFHPAHCARQEPTHSLPQREPPHQLCARGRGEP
SSLPSCTCRAAEAAPVVKREPLDSPQWAAYSQGRAPGMFPKSALTTLVPPQASECTFLP
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgggtgagcttacttttctggtgtgcactgcacgggcgagctgtacttcactggtgtgc
gctgtgggttttagtgtcaacatcttgacgcatgggaggcctgccttgggggtggagaag
tccaacccctccaagcggcaccgggaccgcctcaacgctgagttggaccacctggccagc
ctgctgccgttcccacctgacgtcatctccaagctggacaagctttccgtcttgcgcctc
agcgtcagctacctccgggtgaagagcttcttccaagctgtgcaggagcagggctcacgg
cagctggcggccggcaccccctcgcctggagacagccgtcctgctgcggggtctgcggtg
ctggagggaaggctgctgctggagtctcttactggctttgctctggtcgtgagtgcagaa
gggatgatattttacgcatcagcaacgatcgtggactatctgggcttccaccagaccgac
gtaatgcaccagaacatttacgactacatccacgtggacgaccgccaggacttccgccgg
cagctgcactgggccatggaccctccccaggtggtgtttgggcagcccccgccctccgag
gcaggagatgacgccgtcctggggaggctgctcagggcccaggagtggggcgcaggcgtg
cccaccgagtactctgccttcctgacccgctgcttcgtctgccgtgtgcgctgcctgcta
gacagcacctcaggcttcctgacgatgcagtttcaagggagactaaaattcctgtttgga
cagaagaagaaggcgccctcgggggcggtgctcccaccgcggctgtcgctgttctgcgtt
gctgctccggttctcctcccctccgccacggagatgaagatgaggagcacacttctgagg
accaagcccagggccgacgctgtggcgcccacggatgcaaaagtaaaggccaccgcgagt
ctgtgcgaatcggaactgcatggaaaacccagttactcagcaggaaggagcagcagagaa
agcggcattttggtgctcagggaacagactgacactggccgatgggcacaggttcccgcc
agagccccatgtccgtgcctccggggcagccctgaccttgtcctcgaccccaaggggacc
tcaagggacagggaggaggagcagcagagggtgctgagcagggcctctggagctacaggg
cggagggagatgccgggacccgcaaagctcctgccttggacggcaggaaggcgcagtgag
gatggtgcccggcagaagctgcagcacagccagagtggcctactctccctgcgccccacg
tcccgcggctcctgcctgccctacccgtgtgtccagggcactttcaatgccagtggctcg
ggcacattcaggaacttgcctatctctcagcctccgagcccgtcccccagtgcccacgcc
atccggaccagcagagcctcgcgggatgttagtgaggaccaggtgcaccctcccctctgc
cactttccgcaggggagcctgcagcaccctcagtctgaagctcagcgtttggcctcgagg
ggctatcccacagaggacgtgaagctgcgaggcatgcagatgcctccggggggcctgtgc
ggcccgacactgctgctagatgtgcccatcaagatggagaaggacgctgggtctgaggat
gctgcccatggctgcgtgcccagccaggtgtgggggttaggggccggggagaggagctgt
ccggtcaccttccctaccaggatgcccctgaagacagagccagactccctgcaccaggtc
tacagtgcacacctggggtatggcgtgctgggggctcagccccacaacagggccactgcg
gggcgcagcagggagctggcccgtttccatcccgcacactgcgcgcgccaggaacccacg
cacagccttccccagcgggagcctccccaccagctctgcgcgcggggccgaggcgaaccg
tcctccctgccgagctgcacctgcagagctgctgaggccgcccctgtggtcaagcgcgag
ccgctggactcgccccagtgggccgcttacagccagggaagggcgcctgggatgtttccc
aaaagtgccttgacgacgctggtcccaccccaagcctcagagtgcacattcctgccgtag

DBGET integrated database retrieval system