KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036383Help
Entry
101036383         CDS       T04350                                 

Gene name
NMNAT2
Definition
(RefSeq) nicotinamide mononucleotide adenylyltransferase 2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00760  Nicotinate and nicotinamide metabolism
sbq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    101036383 (NMNAT2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     101036383 (NMNAT2)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     101036383 (NMNAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 101036383
NCBI-ProteinID: XP_003925352
UniProt: A0A2K6S5M6
Position
Unknown
AA seq 307 aa AA seqDB search
MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGL
VSSRHRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
SMTPVIGQPQNETPQPIYQNSNVTNKPTAAKILGKVGESLSRICCVRPPVERFTFVDENA
NLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRI
MNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQ
LYINASG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccaccaagacccacgttatcttgctcgcctgcggcagcttcaatcccatc
accaaagggcacattcagatgtttgaaagagccagggattatctgcacaaaactggaagg
tttattgtgattggcgggattgtctcccctgtccacgactcctatggaaaacagggactc
gtgtcaagccggcaccgtctcatcatgtgtcagttggctgtccagaattccgactggatc
agggtggacccttgggagtgctaccaggacacttggcagacgacctgcagcgtgttagaa
caccaccgggacctcatgaagagggtgactggctgcatcctctccaatgtcaacacacct
tccatgacgcctgtgattggacagccacagaacgagaccccccagcccatttaccagaac
agcaacgtgaccaacaagcccactgcagccaagatcttggggaaggtgggagaaagcctc
agccggatctgctgtgtccgcccgccggtggagcgtttcaccttcgtagatgagaatgcc
aatctgggcacggtgatgcggtatgaagagatcgagctgcggatcctgctgctgtgtggt
agtgacctgctggagtccttctgcatcccagggctctggaacgaggcagatatggaggtg
attgttggagactttgggattgtggtggtgccccgggatgcggccgacacagaccgaatc
atgaatcactcctcaatactccgcaaatacaaaaacaacatcatggtggtgaaagatgac
atcaaccatcccatgtctgtcgtcagctcaaccaagagcaggctggccctgcagcatggg
gacggccatgttgtggattacctgtcccagccggtcatcgactacatcctcaaaagccag
ctgtacatcaatgcctccggctag

DBGET integrated database retrieval system