KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036786
Entry
101036786         CDS       T04350                                 

Gene name
CSRNP3
Definition
(RefSeq) cysteine/serine-rich nuclear protein 3
  KO
K17494  cysteine/serine-rich nuclear protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101036786 (CSRNP3)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101036786 (CSRNP3)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101036786 (CSRNP3)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101036786 (CSRNP3)
SSDB
Motif
Pfam: CSRNP_N Nop14 Nop25 RNA_pol_3_Rpc31
Other DBs
NCBI-GeneID: 101036786
NCBI-ProteinID: XP_003921966
UniProt: A0A2K6U791
Position
Unknown
AA seq 585 aa
MSGILKRKFEEVDGSSPCSSVRESDDEVSSSESADSGDSVNPSTSSHFTPSSILKREKRL
RTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREM
LREHLREEKLNSLKLKMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTK
KRRALLRASGVKKIDVEEKHELRAIRLSREDCGCDCRVFCDPDTCTCSLAGIKCQVDRMS
FPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQIPTLNGCHSEISAHSS
SMGPVAHSVEYSIADSFEIETEPQAAVLHLQSAEELDCQGEEEEEEEDGSSFCSGVTDSS
TQSLAPSESDEEEEEEEEEEEEEDDDDDKGDSFVEGLGTHAEVVPLPSVLCYSDGTAVHE
SHAKNASFYANSSTLYYQIDSHIPGTPNQISENYSERDTVKNGTLSLVPYTMTPEQFVDY
ARQAEEAYGASHYPAANPSVIVCCSSSENDNSVPCNSLYPEHRSSHPQVEFHSYLKGPSQ
EGFVSTLNGDSHISEHPAETSLSLAEKSILHEECIKSPVVETVPV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgagtggaattttaaagaggaagtttgaagaagttgacggctcctcaccctgctcctct
gtgagggaatcagatgatgaagtttccagcagcgaaagtgctgacagtggggacagtgtc
aatccatccacttctagtcattttaccccttcctctattctcaaaagagagaagcggctg
aggacaaagaatgtacattttagttgtgtcaccgtgtactacttcaccaggagacaaggc
ttcacaagtgtgcccagtcaagggggcagcaccctggggatgtccagccgccataacagc
gtgcgccagtacacccttggcgagtttgcaagggagcaggaaaggctccaccgggagatg
ttgagagaacacctcagggaggaaaagctgaactccttaaaactaaagatgactaagaat
ggcacagtggaatcagaagaagccagcacccttacactggatgacatttctgatgatgac
attgacctagacaacacagaggtagatgagtacttcttcctacaacctttgccaacaaag
aaacgaagagctctgctgcgtgcctctggagtgaaaaagattgacgtggaagaaaagcat
gagctgcgagccatccgcctctcgcgagaggactgtggctgtgactgccgagtgttctgt
gatccagacacatgcacttgcagcctggctggcattaagtgccaggtggatcgtatgtct
ttcccatgtggctgcactaaagaaggatgtagtaacacagcaggtagaattgaatttaat
cccatccgtgttcggactcacttcttgcacacaataatgaaacttgaactggagaaaaac
cgagagcagcaaatccccacactgaatggctgccacagtgagataagtgctcacagtagt
tccatgggccctgtcgctcactcggtagaatattcaatcgcagacagttttgagattgaa
actgaaccccaggctgcagtgctgcacctgcagtcggctgaagaattagattgccaagga
gaggaggaggaagaggaggaggatgggagcagcttttgcagcggagtcacagattctagc
acacaaagcttggcacctagtgagtcagatgaggaggaggaggaagaagaagaggaagag
gaggaggaggatgacgatgatgacaaaggagacagcttcgtggaaggtttgggcacccat
gcggaagttgtccctcttccttcagttctttgttattctgatggcaccgccgttcatgaa
agccacgcaaagaatgcttctttttatgccaactcttcaactctgtattaccaaatagat
agccacattccaggaactccaaatcagatctctgagaactattctgaaagagacactgtc
aaaaacggtaccctttcgctggtgccttacaccatgaccccggagcaatttgtggactat
gcccgacaagcagaagaggcctatggtgcctcccactacccagctgccaacccctctgta
attgtttgctgctcctcttccgaaaatgataacagtgtgccctgcaatagtttatatcct
gaacacaggtccagtcaccctcaagtggaatttcactcatacttgaaaggcccctcccag
gaagggtttgtctctacattgaatggtgacagtcacatttcagagcatcctgctgaaacc
tctttgagccttgcagaaaagagcatattgcacgaagagtgcatcaagtcacctgtggtt
gagacagtccctgtttag

DBGET integrated database retrieval system