KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036971
Entry
101036971         CDS       T04350                                 

Gene name
IWS1
Definition
(RefSeq) protein IWS1 homolog isoform X1
  KO
K17498  transcription factor SPN1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101036971 (IWS1)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101036971 (IWS1)
SSDB
Motif
Pfam: Med26
Other DBs
NCBI-GeneID: 101036971
NCBI-ProteinID: XP_003931641
UniProt: A0A2K6SS42
Position
Unknown
AA seq 819 aa
MDSEYYSGDQSDDGGATPVQDERDSGSDGEDDVNEQHSGSDTGSVERHSENEPSDREDGL
TKGHHVTDSENDEPLNLNASDSESEELHRQKDSDSESEERAEPPASDSENEDVNQHGSDS
ESEETRKLPGSDSENEELLNGHASDSENEDVGKHPASDSEIEELQKSPASDSETEDALKP
QVSDSESEEPPRHQASDSENEEPPKPRMSDSESEEIPKPQVSDSESEEPPRHQASDSENE
ELPKPRISDSESEDPPRNQASDSENEELPKPRISDSESEDPPRNQASDSENEELPKPRVS
DSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQNDSVHSDSHMDRKKF
HSSDSEEEELKRQKMDSDEDEKEGEEEKVAKRKAAVLSDSEDEEKASAKKSRVVSDADDS
DSDAVSDKSGKREKTVASDSEEEAGKELSDKKNEEKDLFGSDSESGNEEENLIADIFGES
GDEEEEEFTGFNQEDLEEEKSETQVKEAEDSDSDDNIKRGKHMDFLSDFEMMLQRKKSMS
GKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPTVVMHLKK
QDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRA
VMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMNS
TGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEMESSRFQAT
SKKGISRLDKQMRKFTDIRKKSRSAHAVKISIEGNKMPL
NT seq 2460 nt   +upstreamnt  +downstreamnt
atggactcggaatattacagcggcgaccagtcagatgatggtggtgctaccccagtacag
gatgaacgggattcagggtcagacggtgaggatgatgtaaatgagcaacactccggatca
gacactggaagtgtagaacgtcattcagagaatgaacctagtgatcgagaagatggcctt
accaaaggacatcatgtgacagactctgagaatgatgagcccttaaatcttaatgctagt
gactctgaaagtgaggagcttcacaggcaaaaggacagcgactctgaatctgaggaacgt
gcagaacctcctgcaagtgattctgaaaatgaggatgtcaatcagcatgggagcgactct
gagagtgaggagaccaggaaattacctggtagtgactctgaaaatgaggagcttcttaat
gggcatgcaagtgactcagaaaacgaagatgttggaaagcatcctgccagtgattctgag
attgaggagctccagaagagtcctgccagtgactctgaaacagaagatgctctaaaacct
caggtcagtgactctgagagtgaggaacccccaaggcaccaagccagtgactctgaaaat
gaggaacctcccaaacctcgaatgagtgattctgaaagtgaggagattcctaaacctcag
gtcagtgactcggaaagtgaggaacccccaaggcaccaggccagtgactctgaaaatgag
gagcttcccaaacctcgtatcagtgactcagaaagtgaggaccctccaaggaaccaggcc
agtgactcagaaaatgaagagcttcccaaaccccgaatcagtgattcggaaagtgaggac
cccccaaggaaccaggccagtgattctgaaaatgaagagttacccaaaccccgagtcagt
gactctgaaagtgagggacctcagaagggacctgccagtgactcagaaactgaggatgcg
tccagacacaaacagaagccagagtctgatgatgacagcgacagggagaataagggagag
gatacagaaatgcagaatgactctgtccattcagacagccatatggacagaaaaaagttt
cacagttctgatagtgaggaggaagaactcaaaaggcaaaaaatggacagtgatgaagat
gaaaaagagggtgaggaggagaaagtagcgaagagaaaagctgctgtgctttctgatagt
gaagatgaagagaaagcatcagcaaagaagagtcgtgttgtctctgatgcagatgactct
gacagtgatgctgtatcagacaagtcaggcaaaagagagaagaccgtagcatctgacagt
gaggaagaagcggggaaagaattgtctgataagaaaaacgaggagaaggatctgtttggg
agtgacagtgagtcaggcaatgaagaagaaaatcttattgcggacatatttggtgaatct
ggtgatgaagaggaagaagaatttacaggttttaaccaagaagatctggaagaagaaaaa
agtgaaacacaggtaaaagaagcagaagattcagattctgatgataacataaagagagga
aaacatatggactttctgtcagattttgagatgatgctgcagcgaaaaaagagcatgagt
ggcaagcgcagacggaaccgtgatggtggcacctttattagtgacgcagacgacgtcgtg
agtgccatgattgtcaagatgaacgaagctgctgaggaagatagacagttgaacaatcaa
aaaaagccggcactgaaaaaattaactttattgcctactgtagttatgcaccttaagaag
caggaccttaaagaaacattcattgacagtggtgtgatgtctgctatcaaagaatggctc
tcacctctaccggataggagtttgcccgcactcaagatccgggaggagctgctgaagatc
ctgcaagagctgcctagtgtgagccaggagaccctgaagcatagtgggattggacgagca
gtgatgtatctctataaacaccccaaggaatcaaggtccaacaaggacatggcaggaaaa
ttaatcaatgagtggtctaggcctatatttggtcttacctcaaactacaaaggaatgaca
agagaagaaagggagcagagagatctagaacagatgcctcagcgacgaagaatgaacagc
actggtggtcagacacccagaagagacctggaaaaggtgctgacaggagaggagaaggct
cttagacctggagatcccggattctgtgctcgtgcaagggttccaatgccctcaaacaag
gactatgttgtcaggcccaagtggaatgtggaaatggagtcatccaggtttcaggcgacc
tccaagaaaggtatcagtcgactggataaacagatgagaaagttcacagatatcaggaaa
aaaagcagatctgcacacgcagtgaaaatcagcattgagggcaacaaaatgccattgtga

DBGET integrated database retrieval system