KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037361Help
Entry
101037361         CDS       T04350                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X4
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00561  Glycerolipid metabolism
sbq01100  Metabolic pathways
sbq04714  Thermogenesis
sbq04723  Retrograde endocannabinoid signaling
sbq04923  Regulation of lipolysis in adipocytes
Module
sbq_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    101037361 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101037361 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101037361 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    101037361 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sbq01002]
    101037361 (MGLL)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101037361 (MGLL)
Peptidases [BR:sbq01002]
 Serine Peptidases
  Family S33
   101037361 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 DLH Thioesterase Abhydrolase_5 PGAP1 LIDHydrolase BAAT_C DUF1057 Abhydrolase_2 DUF1350 FSH1 DUF2974
Motif
Other DBs
NCBI-GeneID: 101037361
NCBI-ProteinID: XP_003926177
UniProt: A0A2K6U3A6
Position
Unknown
AA seq 303 aa AA seqDB search
MPEESSPRRTPQSVPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHCGRYDE
LAQMLKGLDLLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDSLQKDYPGLPVFLLG
HSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPID
SSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADR
LCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTSVAGTS
SPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaaagttcccccaggcggaccccgcagagcgttccctaccaggacctccct
cacctggtcaatgcagacggacagtacctcttctgcaggtactggaaacccacaggcaca
cccaaggccctcatctttgtttcccatggagctggggagcactgtggccgctatgatgag
ctggctcagatgctgaaggggctggacctgctggtgtttgcccacgaccacgttggccac
ggacagagcgaaggggagaggatggtagtgtctgacttccatgttttcatcagagatgtg
ttgcagcatgtggattccttgcagaaagactaccctgggcttcctgtcttccttctggga
cattccatgggaggcgccatcgccatccttacggccgcagagagaccgggccacttcgcc
ggcatggtactcatttcgcctctggttcttgccaatcctgaatctgcaacaactttcaag
gtccttgctgcgaaagtgctcaaccttgtgctgccaaacttgtcccttgggcccatcgac
tccagcgtgctctctcggaataagacagaggtcgacatttataactcagaccccctgatc
tgccgggcagggctgaaggtatgctttggcatccagctgctgaacgccgtctctcgggtg
gagcgcgccctccccaagctgactgtgcccttcctgctgctccagggctctgccgaccgc
ctgtgtgacagcaaaggggcctacctgctcatggaatcagccaagagccaggacaagact
ctcaagatttatgaaggtgcctaccatgttctccacaaagagcttcctgaagtcaccaac
tctgtcttccatgaaataaacatgtgggtctctcaaaggacgtccgtggcaggaacttcg
tccccaccctga

DBGET integrated database retrieval system