KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037381Help
Entry
101037381         CDS       T04350                                 

Gene name
TPP2
Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbq01002]
    101037381 (TPP2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sbq03110]
    101037381 (TPP2)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     101037381 (TPP2)
Peptidases and inhibitors [BR:sbq01002]
 Serine peptidases
  Family S8: subtilisin family
   101037381 (TPP2)
Chaperones and folding catalysts [BR:sbq03110]
 Intramolecular chaperones
  Subtilisin family
   101037381 (TPP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 101037381
NCBI-ProteinID: XP_003928280
UniProt: A0A2K6SC55
Position
Unknown
AA seq 1249 aa AA seqDB search
MATAATEEPFPFHGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDG
KPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDF
YPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQASKLIKEELQSQVEL
LNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAE
MLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTR
LSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSA
GNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSADGAL
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRR
ALENTAVKADNIEVFAQGHGIIQVDKAYDYLVQNTSFANKLGFTVTVGNNRGIYLRDPVQ
VAAPSDHGVGIEPVFPENTENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVD
PRGLREGLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESSHYDLAFTDVHFKPGQIR
RHFIEVPEGATWAEVTVCSCSSEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLTE
AFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLK
YEDLAPCITLKSWVQTLRPVSSKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSC
PLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTVRLQIRHEQISDL
ERLKDLPFIVSHRLSNTLSLDIHENHSFALLGKKKSSSLTLPPKYNQPFFVTSLPDDKIP
KGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNGNKDKEKDLEKEKDLKEE
FTEALRDLKIQWMTKLDSSDIYNELKETYPNYLPLYVARLHQLDAEKERMKRLNEIVDAA
NAVISHIDQTALAVYIAMKTDPRPDAATIKNDMDKQKSTLVDALCRKGCALADHLLHTQA
QDGAVSTDAEGKEEEGESPLDSLAETFWETTKWTDLFDNKVLTFAYKHALVNKMYGRGLK
FATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYCVF
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgcgaccgaggagcccttcccttttcacggtctcctgccgaagaaagag
accggagcgtcctccttcctctgccgctacccggagtatgacgggcgtggggtgctcatc
gccgtcctggacacgggggtcgacccgggggctccgggcatgcaggttacaactgatgga
aaaccaaaaatcgttgatatcattgatacaacaggaagtggtgatgtgaatactgctaca
gaggtggagccaaaggatggcgaaattgttggtctttcaggaagagtgcttaagattcct
gcaagctggacaaatccctcaggcaaatatcatattggcataaaaaatggctatgacttc
tatcccaaggctctcaaggaaaggatacagaaagaacgaaaggaaaaaatctgggaccct
gttcacagagtggcccttgcagaagcctgcagaaaacaggaagaatttgatgttgccaac
aatggctcttctcaagcaagtaaactaatcaaggaggagcttcaaagtcaagtggaattg
ctaaattctttcgagaagaaatacagtgatcctggccctgtatatgactgcttggtatgg
catgatggcgaagtctggagagcctgcattgattccaatgaagatggggacttgagtaaa
tctactgtactgagaaactacaaagaagcccaagaatatggctcttttggcacagctgag
atgttgaattactccgttaatatatatgatgatggaaacctgctctccattgtgaccagt
ggaggagctcatgggacacatgtagctagtatagctgctggacactttccagaagaacct
gaacggaatggggtagctcctggtgctcaaattctttctatcaagattggtgatacaaga
ctaagcacaatggaaacaggcacaggcctcataagagctatgatagaagttataaatcat
aagtgtgatcttgtcaactacagttacggagaagcaactcactggccaaattctgggaga
atctgtgaagtaattaatgaagcagtatggaagcataacataatttatgtttcaagtgct
ggaaataatggtccttgcctgtctacagttggttgtccaggtggaactacatcgagtgtg
ataggtgttggtgcttatgtttctcctgatatgatggttgctgagtattcactgagagag
aaattacctgcaaatcaatatacttggtcttctagaggacctagtgctgacggggccctt
ggtgtgagtatcagtgcaccaggaggagccattgcttctgttcctaactggacattgaga
gggacacagctaatgaatggaacatctatgtcttcccccaacgcatgtggaggcattgcc
ctgatcctttcaggtctgaaagctaataacattgactacacagttcattcagtcagaaga
gctctagaaaacactgcagtgaaggctgacaatatagaagtatttgctcaaggacatggt
attattcaggttgataaagcctatgactacctcgttcagaatacatcatttgctaataaa
ttaggttttactgttactgttggaaataaccgtggcatctacctccgagatcctgttcag
gtggctgcaccttcagatcatggcgttggcattgaacctgtatttccagagaacacagaa
aactctgaaaaaatatcccttcagcttcatttagctctgacttcaaattcatcttgggtt
cagtgtcccagccatttggaactcatgaatcaatgtagacacataaacatacgtgtggat
cccaggggcttaagagaaggattgcattatacagaggtatgtggctatgatatagcatcc
ccaaacgcaggtcctctcttcagagttccgatcactgcagttatagcagcaaaagtcaat
gagtcatcacattatgatctagcctttacagatgtacactttaaacctggtcagattcga
agacattttattgaggttcctgagggtgcaacatgggctgaagtgacagtgtgttcgtgt
tcttctgaggtgtcagcaaagttcgttcttcatgcggtccagctggtgaagcaaagagca
tatcgaagccatgaattctataagttttgttctcttccagagaaaggaacactgactgaa
gcttttcctgtcctaggtggaaaagcaattgaattttgcattgctcgttggtgggcaagt
ctcagtgatgtcaacattgattataccatttctttccatgggatagtgtgtactgctcct
cagttaaacattcatgcatcggaaggaatcaaccgttttgatgttcagtcctccttgaaa
tatgaagatctggctccctgcataactttgaagagctgggtccaaacactacgcccagtg
agttcaaaaacaaaacctttaggatcaagagatgttttgccaaataaccgtcaactgtat
gagatggtcctgacatataactttcatcaacccaagagtggggaagtaactccaagctgc
ccattactttgtgaactattatatgaatctgaatttgacagccaactgtggattattttt
gaccagaacaaaagacagatgggttcaggcgacgcctatccacatcagtattctttgaaa
ctggagaaaggagattatacagttcgactgcagattcgccatgagcaaatcagtgacttg
gaacgccttaaagaccttccatttattgtttctcatagattatctaataccttgagctta
gatattcacgaaaatcatagttttgcacttctagggaagaagaaatcaagcagtttgaca
ctaccacccaaatataaccagccattctttgttacttccttacctgatgataaaatacct
aaaggggcaggacctggatgctatcttgcaggatccttaacgttgtcaaagactgaacta
ggaaaaaaagctgatgtaatccctgttcattactacctaatacctccaccaacaaagact
aagaatggcaacaaagataaagaaaaagatttagaaaaagagaaagatttaaaagaagag
tttactgaagcattacgagatcttaaaattcagtggatgacaaagttggattctagtgac
atttataacgaattgaaagaaacatatcctaattatcttcctctgtatgttgcacgactt
catcaattggatgctgaaaaggaacgaatgaaaagacttaatgaaattgttgatgcggca
aatgctgttatttctcatatagatcaaacagccctagcagtttatattgcaatgaagact
gatcccaggcctgatgcagctactataaaaaatgacatggacaaacaaaaatccaccctc
gtagatgccctttgtaggaaaggttgtgccctggcagaccatcttcttcacactcaggct
caagatggagccgtttccactgatgcggaaggaaaggaggaggagggagaaagtcctttg
gattctctggcagaaacattttgggaaactacaaaatggactgatctttttgacaataag
gttttgacatttgcatataagcatgcattagtaaataaaatgtatgggagaggccttaaa
tttgcaactaaacttgtggaagaaaaaccaacaaaagaaaactggaaaaactgtattcaa
ctgatgaagttacttggatggacccattgtgcatctttcactgaaaactggctccccatc
atgtatcctcccgattattgtgtattctaa

DBGET integrated database retrieval system