KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038256Help
Entry
101038256         CDS       T04350                                 

Gene name
PLA2G4B
Definition
(RefSeq) cytosolic phospholipase A2 beta isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00564  Glycerophospholipid metabolism
sbq00565  Ether lipid metabolism
sbq00590  Arachidonic acid metabolism
sbq00591  Linoleic acid metabolism
sbq00592  alpha-Linolenic acid metabolism
sbq01100  Metabolic pathways
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04217  Necroptosis
sbq04270  Vascular smooth muscle contraction
sbq04370  VEGF signaling pathway
sbq04611  Platelet activation
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04724  Glutamatergic synapse
sbq04726  Serotonergic synapse
sbq04730  Long-term depression
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04912  GnRH signaling pathway
sbq04913  Ovarian steroidogenesis
sbq04921  Oxytocin signaling pathway
sbq05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101038256 (PLA2G4B)
   00565 Ether lipid metabolism
    101038256 (PLA2G4B)
   00590 Arachidonic acid metabolism
    101038256 (PLA2G4B)
   00591 Linoleic acid metabolism
    101038256 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    101038256 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101038256 (PLA2G4B)
   04010 MAPK signaling pathway
    101038256 (PLA2G4B)
   04370 VEGF signaling pathway
    101038256 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    101038256 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101038256 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101038256 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    101038256 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    101038256 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101038256 (PLA2G4B)
   04913 Ovarian steroidogenesis
    101038256 (PLA2G4B)
   04921 Oxytocin signaling pathway
    101038256 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101038256 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    101038256 (PLA2G4B)
   04726 Serotonergic synapse
    101038256 (PLA2G4B)
   04730 Long-term depression
    101038256 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101038256 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101038256 (PLA2G4B)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101038256 (PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 101038256
NCBI-ProteinID: XP_010344501
UniProt: A0A2K6S130
Position
Unknown
AA seq 781 aa AA seqDB search
MALAEVSRTCLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPIW
NQSFHFRIHRQLKNVVELKVFDQDLVTGDDPILSVLFDAGTLRAGEFRRESFSLRPQGEG
CLEVEFRLQSLADRAEQLVSNGILVARELSCLHVQLEETGDQKRSERRVQLVVPGSCEGP
QEAPVGTGSFHFHCPACWEQELRIHLQDAPEEQLKVPLSALPSGQLVRLVFPTSQEPLMR
VELKKEEGPKELAVRLGFEPCAEEQAFLSMRKQVVAAALKQALQLDGDLQEDEIPVVAVM
ATGGGIRAMTSLYGQLAALKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTE
LLKTQVTKSKLGVLAPTQLQRYQQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLS
DQREALSHGQNPLPIYCALNTKGQSLTTFEFGEWCEFTPYEVGLPKYGAFIPSELFGSEF
FMGRMMKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWARNQASRDKEQVPL
LKVEEPPSTAGRIAEFFTDLLTWRPLAQATHNFLRGFHFHQDYFQHPHFSTWKATTLDGL
PNQLTPAEPHLCLLDVGYLINTSCPPLLQPTRDVDLILSLDYNLHGAFQQLQLLDRFCQK
QGIPFPPISPSPEEQLRPRECHAFSDPSNPGAPAVLHFPLVSDSFREYSAPGVRRTPEEA
ASGEVNLSPSDSPYHYTKVTYSPQDVDKLLHLTHYNVCNNREQLLEALRQAVQRRRQRRA
Q
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcagaggtgtccaggacctgcctgctcacggtgcgtgtcctgcaggcccat
cgcctgccctcgaaggacctagtgaccccctcggattgctacgtgactctctggctgccc
acagcctgcagccacaggctgcagacacgcacggtcaagaacagcagcagccccatctgg
aaccagagctttcacttccggatccaccggcagctcaagaatgtcgtggaattgaaagtc
tttgaccaggacctggtgactggagatgaccctatactgtcagtgctgtttgatgcaggg
actctgcgggctggggagtttcggcgcgagagcttctcactgaggcctcagggcgagggg
tgcctagaagttgaatttcgcttgcagagcctggctgaccgtgcagagcagcttgtcagc
aatggcatcctggtggcccgggagctctcctgcttgcacgttcaactggaggagacggga
gaccagaagcgctcagagcgcagagttcagcttgtggttcctgggtcctgcgagggtccg
caggaggcccccgtgggcactggcagcttccacttccactgcccagcctgctgggagcag
gagctgaggattcacctgcaggatgctcctgaggagcaactgaaggtgccactgagtgcc
ctgccctctggccaactggtgaggcttgtcttccccacgtcccaggagcccctgatgaga
gtggaactgaaaaaagaagaaggaccgaaggagctggctgtgcgactgggctttgagccc
tgtgcagaagagcaggcgttcttgagcatgaggaagcaggtggtggccgcagccttgaag
caggccctgcagctggacggagacctgcaggaggacgagatcccagtggtagctgttatg
gccactggtggtgggatccgggcaatgacttctctgtatgggcagctggctgccctcaag
gagctgggcctcttggattgcgtctcctacatcaccggggcctcaggctccacctgggcc
ttggctaacctctatgaggacccagagtggtctcagaaggacctggcagggcccactgag
ttgctgaagacccaggtgaccaagagcaagctgggagtgctggcccctacccagctgcag
cggtaccagcaggagctggcggagcgtgcccgcctgggctacccaagctgcttcaccaac
ctgtgggccctcatcaatgaggcgctgctgcacgatgagccccatgaccacaagctttca
gatcagcgagaggccttgagtcacggccagaacccgctgcccatctactgtgccctcaac
accaaggggcagagcctgaccacttttgaatttggggaatggtgtgagttcaccccctat
gaggttggcctccccaagtacggggccttcatcccctccgagctctttggctccgagttc
ttcatggggcggatgatgaagaggctccctgagtcccgcatctgcttcttagaaggtatc
tggagcaacctgtatgcagccaacctccaggacagcttatactgggcctcggagcccagc
cagttctgggaccgttgggccaggaaccaggcgagccgggacaaggagcaggtccccctt
ctgaaggtagaggaaccaccctcaacagctggcaggatagctgagtttttcactgacctc
ctgacatggcgcccgctggcccaggccacacataatttcctgcgtggcttccatttccac
caagactactttcagcatcctcacttctccacctggaaagccaccactctggatgggctc
cccaaccagctgacacccgcggagccccacctgtgcctgctggatgtgggctacctcatc
aacaccagctgcccgcccctcctgcagcccactcgagatgtggacctcatcctgtcatta
gactacaacctgcacggagccttccagcagctgcagctcctggaccggttctgccagaag
caggggatcccgttcccgcccatctctcccagcccagaagagcagctgcggcctcgggag
tgccacgccttctccgacccctccaaccctggagcccctgctgtgctgcactttcctctg
gtcagcgactccttccgggagtactcggcccctggggtccggcggacacccgaggaggca
gcctcgggagaggtgaacctgtctccatcagattctccctaccactacacaaaggtgacc
tacagcccgcaggatgtggataaactgctgcacctgacacattacaatgtctgcaacaac
cgggagcagctgctggaggccctgcgccaggcagtgcagcggaggcggcagcgcagggcc
cagtga

DBGET integrated database retrieval system