KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038485
Entry
101038485         CDS       T04350                                 

Gene name
GPN2
Definition
(RefSeq) GPN-loop GTPase 2
  KO
K24104  GPN-loop GTPase
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101038485 (GPN2)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101038485 (GPN2)
SSDB
Motif
Pfam: ATP_bind_1 MeaB CbiA AAA_31 AAA_30 AAA_22 CLP1_P AAA_16 AAA_24 AAA_18 AAA_17 SRP54 AAA_5
Other DBs
NCBI-GeneID: 101038485
NCBI-ProteinID: XP_010344117
UniProt: A0A2K6UFF0
Position
Unknown
AA seq 310 aa
MARAAPTTAFGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDV
GELVGLGDVMDALRLGPNGGLLYCMEYLEANLDWLRAKLDPLRGHYFLFDCPGQVELCTH
HGALRSIFSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHVNLLSKM
DLIEHYGKLAFNLDYYTEVLDLSYLLDHLASDPFFCHYRQLNEKLVQLIEDYSLVSFIPL
NIQDKESIQRVLQAVDKANGYCFGAQEQRSLEAMMSAAMGTDFHFSSTLGIQEKYLAPSD
QSVEQEAMQL
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcaagggccgctccgaccacggcctttgggcaagcggtgatcggccctccgggctcg
gggaagaccacgtactgcctgggcatgagtgagttcctgcgcgcgctgggccggcgcgtg
gccgtggtgaacctggacccggccaacgaagggctgccgtacgagtgtgccgtggacgtg
ggcgagctggtggggctgggcgacgtgatggacgcgctgcggctggggcccaacggcggc
ctgctctactgcatggagtacctggaagccaacctagattggctgcgtgccaagctcgac
cccctccgcggccactacttcctcttcgactgcccaggccaggtggagctatgcacgcat
cacggcgccctgcgcagcatcttctcccaaatggctcagtgggatctcaggctgactgct
gtccacctcgtggattctcactactgcacagaccctgccaagttcatttcagtactgtgt
acctccctagccaccatgctgcacgtggagctgccccatgtcaacctcctttccaagatg
gacctcattgagcattatgggaagctggccttcaacctggactactacacagaggttctg
gatctctcctaccttcttgaccacctggcttctgaccctttcttctgtcactaccgccag
ctcaatgagaagctagtgcagctcatcgaagactatagcctggtctcctttatccctctg
aacatccaggacaaggagagcatccagcgagtcctgcaggctgtggataaagccaatgga
tactgttttggagcccaagagcagcgaagcctggaggccatgatgtctgctgcaatggga
actgacttccatttctcttccacactgggcatccaggagaagtacctagcaccctcggac
cagtcagtggagcaggaagccatgcagctatag

DBGET integrated database retrieval system