KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038728
Entry
101038728         CDS       T04350                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbq01002]
    101038728 (ADAMTS13)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     101038728 (ADAMTS13)
Peptidases and inhibitors [BR:sbq01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   101038728 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 TSP1_CCN TSP1_spondin Reprolysin_3 Reprolysin_4
Other DBs
NCBI-GeneID: 101038728
NCBI-ProteinID: XP_010350548
Position
Unknown
AA seq 1333 aa
MCQRHLRARCPSLCVAGILACGFLLGCWGPLQFQQSCLQTLEPETVSSYLSPAAPLKGRP
PFPGFQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSL
GAQFRVHLVKMVILTEPESAPNITANLTSSLLSVCGWSQTINPKDDMDPGHADLVLYITR
FDLELPDGNRQVRGVTQLGGACSSTWSCLITEDTGFDLGVTIAHEIGHSPCSRRQLLSLL
SAGRARCVSDPPGPQPGSAGRPPEAQPGLYYSAEEQCRVAFGPKAVACTFAREHLDMCQA
LSCHTDPLDQSSCSRLLVPLLDGTECGVEKWCSKGRCRSLVELTPIAAVNGHWSSWGPPS
RCSRSCGGGVVTRRRQCSNPRPAFGGRACVGADLQAEMCNTQACEKTQLEFMSEQCSRTD
GQPLHSSPGGTSFHHWGAAVPHSQGDALCRHMCRAVGESFIMKRGDSFLDGTRCVPSGPR
EDGTLSLCVSGSCRTFGCDGRMDSQQVWDACHVCGGDNSTCSPRKGSFTAGRAGEYVTFL
TVTPNLTSVYVANHRPLFTHLAVRIGARYVVAGKSSISPSTTYPSLLEDGRVEYRVALTE
DRLPRLEEIRIWGPLQEDAEIQVYRRYGEEYGNLTCPDVTFTYFQPKPQQAWAWAAVRGP
CSVSCGAGLRWVNYSCLDQARKERAETAQCRGSQQPPAWPEACVLEPCPPYWAVGDFGPC
SASCGGGLRERSVRCVEAHGSLLKTLPPALCRAGAQQPAVAETCNPQPCPARTSASWLDA
ISAGEEAPSPLGSTRTGTGAAPVWTPLAGPCSVSCGRGLMKLRFLCMDSALRVPAQEELC
GLASKPGSRWEVCQAVPCPARWRYKLSACSVSCGGGVVQRILYCARAHGEDSDEEILLNT
QCQGLPRPEPQEACSLEPCPPRWKVTSLGPCSASCGLGSARRSVACVQFNRAQDVEVDEA
ACAALVRPQATVPCLSADCTYRWHVEAWTECSVSCGDGIQRRRDTCLVPQAQAPVPTAFC
QHLPKPVTVRGCWAGPCARQGMPSLAPHEEATGPGQTTATPAGASLVWSQAQALPFSPAP
RPWWLLPGHQESPAQSSACGRQLLEPTGTIDMRGPGQADCAVAIGRPLGEVVTLRVLESS
LNCSAGEMLLLWGRLTWRKMCRKLLGMTFSSKTNTLVVRQRCGRPGGGVLLRYGSQPTPE
TFYRECDMQLFGPWGEIVSPSPSPAARNAGGCRLFINVAPHARIAIRALATDMGTGTEGA
NDSYISIRDIHSLRTTTFRGQQVLYWESESSQAEMEFSEGFLKAKASLRGQYWMLQSWVP
GQDPQSWKGKEGT
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgtgccagcgccacctccgggcaagatgcccttccctctgtgtggctggaatccttgcc
tgtggctttctgctgggctgctggggacccttgcaattccagcagagttgtcttcagact
ttggagccagagaccgtgtcttcctacttgagccctgctgctcccttaaaaggccgccct
cctttccctggcttccagaggcagaggcagaggcagaggcgggctgcaggtggcatcctg
cacctggagctgctggtggccgtgggccctgatgtcttccaggctcaccaggaggacacg
gagcgctacgtgctcaccaacctcaacatcggggcagaactgctgcgggacccatccctg
ggggctcagttccgagtacacctggtgaagatggtcattctgaccgagcctgagagtgcc
cccaatatcacagccaacctcacctcgtccctgctgagcgtatgtgggtggagccagacc
atcaaccccaaggacgacatggatcctggccacgctgacctggtcctctatatcaccagg
tttgacctggagttgcctgatggtaaccggcaggtgcggggggtcacccagctgggtggt
gcctgctcctcaacctggagctgcctcattaccgaggacaccggcttcgacctgggagtc
accatcgcccatgagattgggcacagcccttgcagccgccggcagctgctgagcctgctc
agcgcaggacgggcgcgctgcgtgtcggacccaccggggcctcagccagggtctgccgga
cgcccgcccgaagcgcagcctggcctctactacagtgccgaggagcagtgccgcgtggcc
tttggccccaaggctgtcgcctgcaccttcgccagggagcacctggatatgtgccaggcc
ctctcctgccacacagacccactggaccaaagcagctgcagccgcctcctcgtccctctc
ctggacgggacagaatgtggtgtggagaagtggtgctccaagggccgctgccgctccctg
gtggagctgacccccatagcagcagtgaatgggcactggtctagctggggtcccccaagt
cgttgctcccgatcctgcggaggaggtgtggtcaccaggaggcggcagtgcagcaacccc
agacctgcctttggggggcgtgcgtgtgttggtgctgacctccaggccgagatgtgcaac
actcaggcctgtgagaagacccagctggagttcatgtcggaacagtgctccaggacagac
ggccagccattgcactcctcccctggcggcacctccttccaccactggggcgctgctgtg
ccacacagccaaggggatgctctgtgcagacacatgtgccgggctgttggtgagagcttc
atcatgaagcgtggagacagcttcctggatgggacccggtgtgtgccaagtggcccccgg
gaggacgggaccctgagcctgtgtgtgtcgggcagctgcaggacgtttggctgtgatggc
aggatggactcccagcaggtatgggacgcatgccacgtgtgtggtggggacaacagcaca
tgcagcccccggaagggctctttcacagctggaagagccggagaatatgtcacattcctg
acagttacccccaacctgaccagtgtctacgtcgccaaccacaggcctctcttcacacac
ttggcggtgaggatcggagcacgctacgtggtggctgggaagtcgagtatctcccctagc
accacctacccctccctcctggaggatggccgtgttgagtaccgagtggcccttaccgaa
gaccggttgccccgcctggaggagatccgcatctggggacccctccaggaagatgctgag
atccaggtttataggcggtatggcgaggagtatggcaacctcacctgcccagacgtcacc
ttcacctatttccagcctaagccacagcaggcctgggcgtgggccgctgtgcgcgggccc
tgctcggtgagctgtggggcagggctgcgctgggtaaactacagctgcctggaccaggcc
aggaaggagcgggcggagactgcccagtgccgagggagccagcagccaccagcgtggcca
gaggcctgcgtgctcgaaccctgccctccgtactgggcagtgggagacttcggcccgtgc
agtgcctcctgtgggggtggcctgcgggagcggtcagtgcgttgcgtggaggcccacggc
agcctcctgaagacgttgcccccagccctgtgccgagcaggggcccagcagccagccgtg
gcagaaacctgcaacccccagccctgccctgccaggacctctgcatcctggctggatgcc
atctctgcaggggaggaggctccctccccattgggcagtaccaggacggggacaggagct
gcacctgtgtggacccctctggcggggccatgctccgtctcctgcgggcgaggcctgatg
aagctgcgtttcctgtgcatggactctgccctcagggtgcctgcccaggaggagctgtgt
ggcctggcgagcaagcctgggagccggtgggaggtctgccaggctgtcccgtgccctgct
cgatggcggtacaagctgtcggcctgcagcgtgagctgtgggggaggggtcgtgcagagg
atcctgtattgtgcccgggcccatggggaggacagtgatgaggagatcctgttgaacacc
cagtgccaggggctgcctcgcccagaaccccaggaggcctgcagcctggagccctgccca
cctaggtggaaagtcacctcccttggcccatgctcagccagctgtggccttggcagtgct
agacgctccgtggcctgtgtgcaattcaaccgagcccaggatgtggaggtggacgaggcg
gcctgtgcggctctggtgcggccccaggccaccgtcccctgtctcagtgctgattgtacc
taccgctggcatgttgaagcctggacggagtgctctgtttcctgtggggacggcatccag
cgccggcgtgacacctgcctggtaccccaggcccaggcgcctgtgcccacagccttctgc
cagcacttgcccaagccggtgactgtgcgtggctgctgggctgggccctgtgcgagacag
gggatgcccagcctggcaccccacgaagaagccactggtccaggacagaccacagccacc
cctgctggtgcttccttggtgtggtcccaggcccaggccctgcccttctccccagctccc
cggccttggtggctcctgcctgggcaccaggaaagcccagcgcagtccagtgcctgtggc
aggcagctccttgagccaacaggaaccattgacatgagaggcccagggcaggcagactgt
gcagtggccattgggcggcccctcggggaggtggtgaccctccgcgtccttgagagctct
ctcaactgcagcgcgggggagatgttgctgctctggggccggctcacctggaggaagatg
tgcaggaagctgttgggcatgacgttcagctccaagaccaacacgctggtggtgaggcag
cgctgcgggcggccgggaggcggtgtgctgctgcggtacgggagccagcccaccccggaa
accttctacagagaatgtgacatgcagctctttggaccttggggtgaaatcgtgagcccc
tcaccgagtccagccgcgaggaatgcagggggctgccggctcttcatcaatgtggctccg
catgcccggattgctatccgtgccctggccactgacatgggcactgggactgagggagcc
aatgacagctacatttcgatccgggacatccacagtttgaggaccacaacattccgtggg
cagcaggtgctctactgggagtcagagagcagccaggctgagatggagttcagcgagggc
ttcctgaaggcaaaggccagcctgcggggccagtactggatgctccaatcttgggtgcca
gggcaggaccctcagtcctggaagggaaaggaaggaacctga

DBGET integrated database retrieval system