KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038896Help
Entry
101038896         CDS       T04350                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101038896 (MAP4K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101038896 (MAP4K4)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101038896 (MAP4K4)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: STE group
  STE20 family
   101038896 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 101038896
NCBI-ProteinID: XP_010346931
Position
Unknown
AA seq 1329 aa AA seqDB search
MDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITD
LVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVS
AQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCD
MHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNE
RQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRD
FLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRR
EREARRQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEE
QRHLEVLQQQLLQEQAMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRPHPQH
AQQPPPPQQERSKPSYHAPEPKAHYEPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPP
VPSRSESFSNGNSESVHPVLQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPPKFAHH
HLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRR
DSPLQGSGQQNSQAGQRNSTSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQ
SGSGERFRVRSSSKSEGSPSQRLENAVKKPEDKKEVFRPLKPAGEVDLTALAKELRAVED
VRPPHKVTDYSSSSEESGTTDEEDDDVEQEGADESTSGPEDTRAASSLNLSNGETESVKT
MIVHDDVESEPAMTPSKEGTLIVRQSTVDQKRASHHESNGFAGRIHLLPDLLQQSHSSST
SSTSSSPSSSQPTPTMSPQTPQDKLTANETQSASSTLQKHKSSSSFTPFIDPRLLQISPS
SGTTVTSVVGFSCDGMRPEAIRQDPTRKGSVVNVNPTNTRPQSDTPEIRKYKKRFNSEIL
CAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLR
VYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAW
APKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLP
THIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRS
NQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMT
LGRTSLLSW
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcactgaggatgaagaggaagaaatcaaactggagataaatatgctgaagaaa
tattctcatcacagaaatattgcaacatattatggtgctttcatcaaaaagagccctcca
ggacatgatgaccaactctggcttgttatggagttctgtggggctgggtccattacagac
cttgtgaagaacaccaaagggaacacactcaaagaagactggattgcctacatctccaga
gaaatcctgaggggactggcacatcttcacattcatcatgtgattcaccgggatatcaag
ggccagaatgtgttactgactgagaatgcagaggtgaaacttgtcgactttggtgtgagt
gctcagctggacaggacggtggggcggagaaatacattcataggcactccctactggatg
gctcctgaggtgatcgcctgtgacgagaacccagatgccacctatgattacagaagtgat
ctttggtcttgtggcattacagccattgagatggcagaaggtgctccccctctctgtgac
atgcatccaatgagagcactgtttctcattcccagaaaccctcctccccggctgaagtca
aaaaaatggtcgaagaaattttttagttttattgaagggtgcctagtgaagaattacatg
cagcggccctctacagagcagcttttgaaacatccttttataagggatcagccaaatgaa
aggcaagttagaatccagcttaaggatcatatagatcgtaccaggaagaagagaggcgag
aaagatgaaactgaatacgagtacagtgggagtgaggaagaagaggaggaagtgcctgaa
caggaaggagagccaagttccattgtgaacgtgcctggtgagtctactcttcgtcgagat
tttctgagactgcagcaggagaacaaggaacgttctgaggctcttcggagacaacagtta
ctacaggagcaacagctccgggagcaggaagaatataaaaggcaactgctggcggagaga
cagaagcggattgagcaacagaaagaacagaggcgacggctagaagagcaacaaaggaga
gagcgtgaagctagaaggcagcaggaacgtgaacagcgaaggagagaacaagaagaaaag
agacgtctagaggaattggagagaaggcgcaaagaagaagaggagaggagacgggcagaa
gaagaaaagaggagagttgaaagagaacaggagtatatcaggcgacagctagaagaggag
cagcggcacttggaagtccttcagcagcaactgctccaggagcaggccatgttactggag
tgccgatggcgggagatggaggagcaccggcaggcagagaggctccagaggcagttgcaa
caagaacaagcctatctcctgtctctacagcatgaccataggaggccgcacccgcagcat
gcgcagcagccgccaccaccgcagcaggaaaggagcaagccaagctaccacgctcccgag
cccaaagcccactatgagcctgccgaccgagcacgagaggtggaagatagatttaggaaa
actaaccacagctcccctgaagcccagtctaagcagacaggcagagtattggagccacca
gtgccttcccgatcagagtctttttccaatggcaactccgagtctgtgcatcctgtcctg
cagagaccagcggagccacaggtacagtggtcccacctggcatctctcaagaacaatgtt
tcccctgtctcgcgatcccattccttcagtgacccttctcctcccaaatttgcacaccac
catcttcgttctcaggacccatgtccaccttcccgcagtgaggtgctcagtcagagctct
gactctaagtcagaggcgcctgaccctacccaaaaggcttggtctagatcagacagtgac
gaggtgcctccaagggttcctgtgagaacaacatctcgctcccctgttctgtcccgtcga
gattccccactgcagggcagtgggcagcagaatagccaggcaggacagagaaactccacc
agtattgagcccaggcttctgtgggagagagtggaaaagctggtgcccagacctggcagt
ggcagctcctcagggtccagcaactcaggatcccagcccgggtctcaccctgggtctcag
agtggttctggggaacgcttcagagtgagatcatcatccaagtctgaaggctctccatct
cagcgcctggaaaatgcagtgaaaaaacctgaagataaaaaggaagttttcagacccctt
aagcctgctggcgaagtggatctgactgcactggccaaagagcttcgagcagtagaagat
gtacggccacctcacaaagtaacggactactcctcatccagtgaagagtcggggacgacg
gatgaggaggacgatgatgtggagcaggaaggggctgacgagtccacctcgggaccagag
gacaccagagcagcgtcatctctgaatttgagcaatggtgaaacggaatctgtgaaaacc
atgattgtccatgacgatgtagaaagtgagccggccatgaccccatccaaggagggcact
ctaatcgtccgccagagtacagttgaccaaaagcgtgccagccatcatgagagcaatggc
tttgccggtcgcattcacctcttgccagatctcttacagcaaagccattcctcctccact
tcctccacctcctcctccccatcctccagccagccgacacccaccatgtccccacagaca
ccccaggacaagctcactgctaatgagactcagtccgctagtagcacactccagaaacac
aaatcttcctcctcctttacaccttttatagaccccagattactacagatttctccatct
agtggaacaacagtgacttctgtggtgggattttcctgtgatggaatgagaccagaagcc
ataaggcaagatcctacccggaaaggctcagtggtcaatgtgaatcccaccaacactagg
ccacagagtgacaccccggagattcgtaaatacaagaagaggtttaactctgagattctg
tgtgctgccttatggggagtgaatttgctagtgggtacagagagtggcctgatgctgctg
gacagaagtggccaagggaaggtctatcctctgatcaaccgaagacgatttcaacaaatg
gatgtacttgagggcttgaatgtcttggtgacaatatctggcaaaaaggataagttacgt
gtctactatttgtcctggttgagaaataaaatacttcataacgatccagaggttgagaag
aagcagggatggacaaccgtaggagatttggaaggatgtgtacattataaagttgtaaaa
tatgaaagaatcaaatttctggtgattgctttaaagagttctgtggaagtctatgcgtgg
gcaccaaagccatatcacaaatttatggcctttaagtcatttggagaattggtacataag
ccattactggtggatctcactgttgaggaaggccagaggttgaaagtgatctatggatcc
tgtgctggattccatgctgttgatgtggattcaggatcagtctatgacatttatctacca
acacacatccagtgtagcatcaaaccccatgcaatcatcatcctccccaacacagatggg
atggagcttctggtgtgctatgaagatgagggggtttatgtaaacacgtatggaaggatc
accaaggatgtagttctacagtggggagagatgcccacgtcagtagcatatattcgatcc
aaccagacaatgggctggggagagaaggccatagagatccgatctgtggaaactggtcac
ttggatggtgtgttcatgcacaaaagggctcagagactaaaattcttgtgtgaacgcaat
gacaaggtgttctttgcctctgttcggtctggtggcagcagtcaggtttatttcatgacc
ttaggcaggacttctcttctgagctggtag

DBGET integrated database retrieval system