KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038974
Entry
101038974         CDS       T04350                                 

Gene name
RPAP2
Definition
(RefSeq) putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 isoform X1
  KO
K20827  RNA polymerase II-associated protein 2 [EC:3.1.3.16]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101038974 (RPAP2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101038974 (RPAP2)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101038974 (RPAP2)
Protein phosphatases and associated proteins [BR:sbq01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   101038974 (RPAP2)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101038974 (RPAP2)
SSDB
Motif
Pfam: RPAP2_Rtr1
Other DBs
NCBI-GeneID: 101038974
NCBI-ProteinID: XP_003933354
UniProt: A0A2K6TYI0
Position
Unknown
AA seq 612 aa
MADWAGWRSAGRKAGTRRRSRNAAGTKQTSTLKQEDASKRKGELEAAVRKKIEFERKALH
IVEQLLEENITEEFLMECGKFITPAHYRDVVDERSIVKLCGYPLCQKKLGIVPKQKYKIS
TKTNKVYDITERKSFCSNFCYQASKFFEAQIPKTPVWVREEERHPNFQLLKEGQSCHSGV
EVELCSKAIKTSDIHCPSHFEKQYESSSSSTHSDSSSDNEQDFVSSILPGNRPNSTSIRP
QLHQKSIMKKKAGPKANSIHKDKEQTVVDVTEQLGNCKLDSQEKAATGELPLQKVNTENS
SNSTLPERLKASGNSESKYSRSEITLVGISKKSAEHFKRKFAKSNQVSRSVSGSVQVCLE
VGKRNLLKILRETLIEWKTEETLRFLYGQNYASVCLKPEASLVKEELDEDDIISDPDSHS
LAWRESQNSLDESLPFMGSDTASKPLPSYENLKKETEKLNLRIREFYRGRYVLDEETTKS
QDSEEHDSTFPLIDSSSQNQIRKRIVLEKLSKVLPGLLGPLQITLGDIYTQLKNLVRTFR
LTNRNIIHKPAEWTLIAMVLLSLLTPILGIQKHSQEGIVFTRFLDTLLEELQLKNEDLES
LTIIFRTSCLPK
NT seq 1839 nt   +upstreamnt  +downstreamnt
atggcggactgggcagggtggcgctccgccggccgaaaggccgggactcgccgccgctct
cgaaacgccgcaggtactaaacagacaagtactttgaaacaagaagatgcttctaaaagg
aaaggagaactagaagcagctgtgagaaagaagattgaatttgagagaaaagctctacat
attgttgaacagcttttagaagagaatattacagaagaattcctaatggagtgtgggaag
tttattacacctgctcactacagggatgtcgttgatgaacgttctattgtcaaactctgt
ggttatcctttatgtcagaagaagctgggaattgtaccaaaacagaaatataaaatttct
accaaaaccaataaagtctatgatattactgaaagaaagtctttttgcagcaatttttgt
tatcaagcatctaagttttttgaagcacaaattcccaaaactccagtgtgggttcgagaa
gaagagaggcatcccaattttcaactgctaaaggaaggacaaagttgccattctggagta
gaagtagagttatgcagtaaagccattaaaacatcagatatacactgtcctagccacttt
gaaaagcaatatgaatctagttcttccagcactcatagtgatagtagcagtgataatgag
caagactttgtttcctccattctaccaggaaacagaccaaattcaacaagtattagacca
cagctgcaccagaaaagcataatgaaaaagaaggctggccccaaagctaactccatacac
aaagacaaagaacagacagtagtagatgtcactgagcagttaggcaattgcaaattagat
agtcaggagaaagctgctacaggtgaacttcctttacagaaggtaaatactgagaattct
tcaaatagtactttgcctgaaagattaaaagcttcaggtaattctgaaagtaaatacagt
aggtcagaaataactctagtaggcataagtaagaaaagtgcggagcattttaagagaaaa
tttgccaaatcaaaccaagtgtctaggtcagtatctggttcagtgcaggtgtgtcttgaa
gttggaaagagaaatttacttaaaattttgagggagactttgattgagtggaagacagaa
gaaactttgaggtttttgtatggccagaattatgcttctgtgtgcctgaaacccgaagcc
tctctggttaaagaagaacttgatgaagatgacataatctcagatccagatagtcattcc
cttgcttggagggaatctcagaacagcttggatgagtctttaccttttatgggctcagat
acagccagtaaaccactgcccagttacgagaacttgaaaaaagaaactgaaaagttaaat
ctgaggatcagggagttttatagaggacgatatgttttggatgaagaaaccaccaaatca
caagactcagaagagcatgattctacctttccactgatagactcaagttcccagaaccag
attagaaaacgcatcgtacttgaaaagttgagtaaagtattgcctggacttctgggtcct
cttcagattacgttgggagatatttacacacaacttaaaaatcttgttcgaactttcagg
ttaacaaatagaaatattatacacaaacctgcggaatggactttaattgctatggtgttg
ctgtcattactgaccccaattcttggcattcagaaacattctcaggaaggtatagtgttt
acacggtttctagacaccctgcttgaagagttacagctaaagaatgaagaccttgaaagt
ttaaccatcatatttagaaccagctgtttaccaaagtga

DBGET integrated database retrieval system