KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039159Help
Entry
101039159         CDS       T04350                                 

Gene name
METTL14
Definition
(RefSeq) N6-adenosine-methyltransferase subunit METTL14 isoform X1
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sbq03019]
    101039159 (METTL14)
Enzymes [BR:sbq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     101039159 (METTL14)
Messenger RNA biogenesis [BR:sbq03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     101039159 (METTL14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 101039159
NCBI-ProteinID: XP_010338657
UniProt: A0A2K6RZT8
Position
Unknown
AA seq 456 aa AA seqDB search
MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAP
NAKRKYLDEGETDEDKIEEYKDELEMQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYC
QHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIR
ELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEG
LDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRST
DGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTV
GPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG
TSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggatagccgattgcaggagatccgggagcggcagaagttacggcgacagctcctcgcg
cagcagttgggagctgaaagtgccgacagcattggtgctgtgttaaatagcaaagatgag
cagagggaaattgctgaaacaagagaaacttgcagggcttcctatgatacctctgctcca
aatgcaaaacgtaagtatctggatgaaggagagaccgatgaagacaaaatagaggaatat
aaggatgaactagaaatgcaacaggaggaagaaaatttgccatatgaagaagaaatttac
aaagattctagtacttttcttaagggaacgcagagcttaaatccacataatgattactgc
caacattttgtagacactggacatagacctcagaatttcatcagggatgtaggattagct
gacagatttgaagaatatcctaaactgagggagctcatcaggctaaaggatgagttaata
gctaaatctaacactcctcctatgtacttacaagcagatatagaagcctttgacatcaga
gaactaacacccaaatttgatgtgattcttctggaaccccctttagaagagtattacaga
gaaactggcatcactgctaacgaaaaatgctggacttgggatgatattatgaagttagaa
attgatgagattgcagcacctcgatcgtttatttttctctggtgtggttctggggagggg
ttggaccttggaagagtgtgtttacgaaaatggggttacagaagatgtgaagatatttgt
tggattaaaaccaataaaaacaatcctgggaagactaagactttagatccaaaggctgtc
tttcagagaacaaaggaacactgcctcatggggatcaaaggaactgtgaagcgtagcaca
gatggggacttcattcatgctaatgttgacattgacttaattatcacagaagaacctgaa
attggcaacatagaaaaacctgtagaaatttttcatataattgagcatttttgtcttggt
agaagacgccttcatctatttggaagagatagtacaattcgaccaggctggctcacagtt
ggaccaacgcttacaaatagcaactacaatgcagaaacatatgcatcctatttcagtgct
cctaattcctacttgactggttgtacagaagaaattgagagacttcgaccaaaatcacct
cctcctaaatctaaatctgaccgaggaggtggagctccccgaggtggaggaagaggtgga
acttccgctggccgtggacgagaaagaaatcgatctaacttccgaggagaaagaggtggc
tttagagggggccgtggaggagcacacagaggtggcttcccacctcggtaa

DBGET integrated database retrieval system