KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040136Help
Entry
101040136         CDS       T04350                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04260  Cardiac muscle contraction
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04921  Oxytocin signaling pathway
sbq05410  Hypertrophic cardiomyopathy (HCM)
sbq05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
sbq05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101040136 (CACNG3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101040136 (CACNG3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101040136 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    101040136 (CACNG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101040136 (CACNG3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101040136 (CACNG3)
   05414 Dilated cardiomyopathy (DCM)
    101040136 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sbq04040]
    101040136 (CACNG3)
Ion channels [BR:sbq04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101040136 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 ABC2_membrane_2
Motif
Other DBs
NCBI-GeneID: 101040136
NCBI-ProteinID: XP_003930255
UniProt: A0A2K6SV01
Position
Unknown
AA seq 315 aa AA seqDB search
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggtatccagatgttgatcaccactgtgggagcctttgcagct
tttagtttaatgaccattgcagtgggcacggactactggttatattccagaggtgtgtgc
aggactaaatctacaagtgataatgaaaccagcaggaagaatgaagaagtaatgacccat
tcggggctgtggaggacctgctgcctagaaggggctttccgaggcgtgtgtaagaaaatt
gatcacttccctgaagatgctgactacgaacaggatacagctgagtatctcctgcgagcc
gtgagggcctccagtgtcttccccatcctcagtgtcacgctgctgtttttcggcgggctc
tgtgtggcagccagcgagtttcaccgcagcagacataatgtcattctcagcgcaggcatc
ttttttgtctctgcagggttaagcaacatcatcggcatcatagtttatatatcagccaat
gccggagaccctgggcaacgtgactccaaaaaaagttactcctatggttggtccttttat
ttcggagccttctctttcatcatcgcagaaattgtaggagtggttgccgtgcacatctat
attgaaaaacatcagcagttacgagccaaatcccactcggagttcctgaagaaatctact
tttgcccgcctcccaccctacaggtatcgattccggaggcggtcaagttctcgctccacc
gagcccagatcccgagacctgtcccccatcagcaaaggcttccacaccatcccttccact
gacatctcgatgttcactctctcccgggacccctcaaagatcaccatggggaccctcctc
aactctgaccgggaccacgcttttctacagttccacaattccacgcccaaagagttcaaa
gagtcactgcataataatccggccaacaggcgcaccacgcccgtctga

DBGET integrated database retrieval system