KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040162
Entry
101040162         CDS       T04350                                 

Gene name
RPAP1
Definition
(RefSeq) RNA polymerase II-associated protein 1 isoform X1
  KO
K20826  RNA polymerase II-associated protein 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101040162 (RPAP1)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101040162 (RPAP1)
SSDB
Motif
Pfam: RPAP1_C RPAP1_N ATP-synt_B THOC2_N
Other DBs
NCBI-GeneID: 101040162
NCBI-ProteinID: XP_003935738
UniProt: A0A2K6U0E1
Position
Unknown
AA seq 1392 aa
MLSRPKPGESEVDLLRFQSQFLAAGAAPAVQLVKKGNRGSGDANSNQHPLQDHRDVVMLD
NLPDLPPALVPSPPKRARPSPGHPLPEDEDPEERLRRHDQHITAVLTKIIERDTSSVAVK
LPVPSAVAFPPVFHRSRDTQGRSATSGKRSIFAQEIAARRISEARVPSVGEVVPNLGPPE
GAVTCETPAPRDQGSQLPGSSHSFQGPNLVTGKGLRGQEAEQEAQTIHEENVARLQAMAP
EEILQEQQRLLAQLDPSLVAFLRSHSRTQEQTGEKASEEQRPGGPSANVTKEEPLMSSSA
NKPKKGDKLEPEAPVLALPMTLQKEWLHMDTVELEKLHWTQDLPPLRRQQTQERMQARFS
LQGELLAPDVDLPTHLGLHHHGEEAERAGYSLQELFHLTRSQVSQQRALALHVLAQVISR
AQAGEFGDRLAGSVLSLLLDAGFLFLLRFSLDDRVDGVIAAAIRALRALLVAPGDEELLD
STFSWYHGALTFPLVPSQEDKEDEDEDEEHPAEKAERKSPEEDSRPPPDLARHDVIKGLL
ATSLLPRLRYVLEVTYPGPAVVLDILAVLIRLARHSLESATRVLECPRLIETIVREFLPT
SWSPFGSGPTPSLYKVPCATAMKLLRVLASAGRNIAARLLSSFDLRSRLCRFIAEAPQEL
TLPPEEAETLSIEALRLWAVAASYGQGGDLYRELYPVVMRALQVVPQELSTHPPQPLSMQ
RIASLLTLLTQLTLAAGSNPAETISNSVEASLSVTSLVTWTQVSGLQPLVELCLRQTLKL
LSRPEMWRAVGPVPAACLLFLGAFYQAWSQQPSSCPEDWLQDMERLSEELLLPLLSQPTL
GSLWDSLRHCSPLCNPLSCAPAPEAPPSLVSLGCSGGCPPFSLAGSASPFPFLTALLSLL
NTMAWIHKGLCGQLAAVLAAPGLQKYFLRCVAPGAAPPLTPFSAWALRHEYHLQYLALAL
AQKAATLQPLPATHAALYHGMALALLSRLLPGSEYLAHELLLSCVFRLEFLPERTSGGPE
AADFSDQLSLGSSRAPRCGQGALLAQACQDLPSIRSCYLTHCSPAQASLLASQALYRAEL
RRLPTLLLPVPTEPLLPTDWPFLPLIRLYHRVSDTPSGVPPTDTVGTAMRVLQWVLVLES
WRPQALWAVPPAAHLARLMCVFLVDSELFRESPVQRLVAALLAQLCQPQVLPNLNLDCPL
PGLTSFPDLYANFLDHFEAVSFGDHLFGALVLLPLQRRFSVTLRLALFGEHVGALRALSL
PLTQLPVSLECYTVPPEDNLALLQLYFRTLVTGVLRPHWCPVLYAVAVAHVNSFIFSQDP
QSSDEVKAARRRMLQKTWLLADEGLRQHLLHYKLPNSTLPEGFELYPQLPPLRQHYLQRL
TSTVLQNGVSET
NT seq 4179 nt   +upstreamnt  +downstreamnt
atgctgtcgagaccaaagccaggggagtctgaggtggacctgctgcgcttccagagtcag
tttcttgcagctggtgcagccccagcggtgcagttggtgaagaaaggaaataggggcagt
ggtgatgccaactcaaaccagcatccgctacaggaccatcgggatgtggtgatgttggac
aatctcccagatctgcccccagctttggtcccttctcccccgaagagagccagacccagc
cctggccacccgctgcctgaggatgaggacccagaagagaggctgagaaggcatgatcag
cacatcactgctgtcttgactaagattattgaacgagatacaagttcagtggccgtgaag
ctgcctgtgcccagtgctgttgctttcccccctgtgttccatcgctctcgggacacacag
gggagatcagcaacatctggtaagagaagcatctttgcccaagagattgcagcaaggaga
atatctgaagccagggtcccatcagttggggaagtagtgcccaatttgggcccaccagag
ggcgccgtgacctgcgagacaccggctcctagggaccagggctcccagcttcctggaagc
agccacagcttccagggacctaatctggtcacagggaagggactcaggggtcaagaagct
gagcaggaagcccaaactatccatgaagaaaacgtagcaagactgcaggccatggctcct
gaggagatcctgcaggaacagcagcggttgctggcgcagcttgaccccagcttggttgct
ttcttgagatctcacagccgcacccaagagcaaacaggagagaaggcctctgaggagcag
aggccaggagggccctctgctaatgtcaccaaggaggaacccctcatgtcatcttctgcc
aataagcccaagaagggagacaagctggagccagaagccccagttctggcactgcccatg
acccttcagaaagaatggctgcacatggacactgtcgagctggagaagctccactggacc
caggacttgccccctctccggcggcagcagacacaggagaggatgcaggctcgattcagt
cttcagggagaactactggcccctgacgtggacctgcccacccacctgggtctacaccac
catggagaggaggcagagagagcagggtactccctacaggagctgttccacctgacccgc
agccaggtgtcccagcagagagcactggcactgcatgtgttggcccaagtcataagcagg
gcccaggctggtgagtttggggaccggctagccggcagtgtcttaagcctccttttggat
gctggtttcctcttcctactacgcttttccttggatgacagagtagatggggtcattgca
gccgccatccgtgctcttcgggctctgctggtggctcctggagatgaggaactcctcgac
agcaccttctcttggtaccatggagctttgacgttccctctcgtgcccagtcaggaggac
aaggaagatgaagatgaggatgaagaacacccagcagaaaaggctgaaaggaaaagccct
gaagaagacagccggcctccacctgacctggcccgacatgatgtcatcaaggggctcctg
gctaccagcctcctgcctcggctgcgctatgtgctggaggtgacctacccaggacctgct
gtggttcttgacatcctggccgtgctcatccgcctcgcccggcattccctggagtcagcc
acaagggtcctggagtgccctcggctgatagagaccatagttcgagagttcttgcccacc
agctggtctccttttgggtcaggacctacccccagtctatacaaagtaccctgtgctact
gccatgaaactacttcgtgtcctggcctcagctgggaggaatattgctgctcggctgttg
agcagctttgatctccggagccgcctgtgccgcttcatagctgaggctccccaagaactg
accttgcccccggaggaagctgagacgctgagcattgaggctctccgtttgtgggcagtg
gctgcctcctatggccagggcggtgacctttacagggagctctacccagtggtgatgcgg
gccttgcaggtggtgccacaggagctcagtacccacccgcctcagcccctgtccatgcag
cggatagcctcactgcttactctcctcacccagctgaccctggcagctggcagcaacccc
gctgaaaccatcagcaactctgttgaggccagcctctcagttacctccttagtcacttgg
acacaggtgtctgggctccagcctcttgtcgagctgtgtctaaggcaaaccttgaagttg
ctgtccagacctgagatgtggagagccgtgggcccagtgcctgctgcctgcctgttgttc
ctgggcgccttctaccaggcctggagccagcaaccaagctcatgcccagaggattggctc
caggacatggagcgcctgtcggaggagctgttgctgccactgctgagccagcccaccctg
ggcagcctgtgggattcccttaggcactgctcccctctctgcaacccgctgtcctgtgcg
ccagcccctgaagctccccccagcctcgtgtcactgggctgctcaggaggctgcccccct
ttcagtctggctggctcagcctcacccttcccattcctcactgccctcctctctcttctc
aataccatggcctggatccacaaggggctgtgtggccagttggctgccgtattggctgcc
ccgggactccagaagtacttcctccgttgtgtggctcctggggctgcccctcccctcaca
ccgttctctgcgtgggccctgcgtcatgagtaccacctgcagtacctggcactcgctctg
gcccagaaagcggcaacactgcagccattgccagccacccatgctgccctttatcatggt
atggccttggccctgctgagccggctgctgcccggaagcgagtacctcgcccatgagctg
ctgctgagctgtgtattccggctggagttcctcccggaaagaacatcagggggtccagag
gcagctgacttctctgaccagctgtctttaggaagcagcagggcccctcggtgtgggcaa
ggggctctgctagctcaggcctgccaggacctccccagcatccgcagctgctacctgact
cactgctcgccagcccaagccagtctgttggcctcccaggctctgtaccgagcggagcta
cggcgactcccgaccctgctactgcctgtgcctacggagccgctgctgcccaccgactgg
cccttcctgccactgattcgcctctaccaccgggtttcagacaccccctcgggggtccct
cccacagacaccgtgggcacagccatgcgggtcctgcagtgggtgctagttctggagagc
tggcgcccccaggccctctgggctgtgccccctgctgcccacctggcacggctcatgtgt
gtgttcctggtggacagtgagctgttccgggagtccccagtacagcgtctggtggcagcc
ctcctagcccagctctgtcagcctcaagtcttgccaaacctcaacctggactgcccactc
cctggcctgacgtctttcccggacctctatgccaacttcctggatcattttgaggctgtc
tcttttggggaccacctctttggggccctggtcctcctgcctctgcagcgtcggttcagt
gtcactttgcgcctcgccctctttggggaacacgtgggagctttgcgagctctgagcctg
cctctgactcagttgcctgtgtccctggagtgctacacggtacctcctgaagacaacctg
gccctccttcagctctacttcaggaccctggttactggtgtgctccgtccacattggtgc
cctgtgctctatgctgtggctgtggctcatgtcaatagcttcatcttctctcaggaccca
cagagctcagatgaggtaaaggctgcccgcaggcgtatgctgcagaaaacatggctgctg
gcagatgagggtctccggcagcaccttctccactataagcttcccaattccacgcttcca
gagggctttgagctctatcctcagttgccccctctgcgtcagcactacctccagagactg
acttcaacggtgctccaaaatggggtatcagagacctag

DBGET integrated database retrieval system