KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041573Help
Entry
101041573         CDS       T04350                                 

Gene name
ST3GAL3
Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X1
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00514  Other types of O-glycan biosynthesis
sbq00515  Mannose type O-glycan biosynthesis
sbq00533  Glycosaminoglycan biosynthesis - keratan sulfate
sbq00601  Glycosphingolipid biosynthesis - lacto and neolacto series
sbq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    101041573 (ST3GAL3)
   00514 Other types of O-glycan biosynthesis
    101041573 (ST3GAL3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    101041573 (ST3GAL3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    101041573 (ST3GAL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sbq01003]
    101041573 (ST3GAL3)
Enzymes [BR:sbq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     101041573 (ST3GAL3)
Glycosyltransferases [BR:sbq01003]
 Terminal extension
  Sialyltransferase
   101041573 (ST3GAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 101041573
NCBI-ProteinID: XP_003936992
UniProt: A0A2K6SVI5
Position
Unknown
AA seq 375 aa AA seqDB search
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSNSAVLSFDSAGQTLGSEYDRL
GFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARI
REFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDD
YDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLK
YIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIP
TLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYESVRMAAIKESWTHNIQREKEFLR
KLVKAHVITDLSSGI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgggactcttggtatttgtgcgcaatctgctgctagccctctgcctctttctggtactg
ggatttttgtattactctgcgtggaagctacacctactccagtgggaggaggactccaat
tcagcggttctttcctttgactccgctggacaaacactaggctcagagtatgatcggttg
ggcttcctcctgaatctggactctaaactgcctgctgaattagccactaagtacgcaaac
ttttccgagggagcttgcaagcccggctatgcttcagccttgatgacggccatcttcccc
cggttctccaagccagcacccatgttcctggatgactcctttcgcaagtgggctcgaatc
cgagagtttgtgccgccttttgggatcaaaggtcaagacaatctgatcaaagccatcttg
tcagtcaccaaagagtaccgcctgacccctgccttggacagcctccgctgccgccgctgc
atcatcgtgggcaatgggggcgttcttgccaacaagtctctggggtcccgaattgacgac
tatgacattgtggtgagactgaactcagcaccagtgaaaggctttgagaaggacgtgggc
agcaaaacgacactgcgcatcacctaccccgagggcgccatgcagcggcccgagcagtac
gagcgtgattctctctttgtcctcgctggcttcaagtggcaggactttaagtggttgaaa
tacatcgtctacaaggagagagtgagtgcatcggatggcttctggaaatctgtggccact
cgagtgcccaaggagccccctgagattcgaatcctcaacccatatttcatccaggaggcc
gccttcaccctcattggcctgcccttcaacaatggcctcatgggccgggggaacatccct
acccttggcagtgtggcggtgaccatggcactacatggctgtgatgaggtggcagtcgca
ggatttggctatgacatgagcacacccaacgcgcccctgcactactatgagagcgtgcgc
atggcagccatcaaagagtcctggacgcacaatatccagcgagagaaagagtttctgcgg
aagctggtgaaagctcatgtcatcactgatctaagcagtggcatctga

DBGET integrated database retrieval system